NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, February 27, 2024, starting at 8:00 a.m. EST for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS7750.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7750.1 Public Homo sapiens 11 RRM1 24 110 108 CCDS HistoryNCBI Gene:6240Re-query CCDS DB by CCDS ID:7750.1Re-query CCDS DB by GeneID:6240See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7750.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000300738.10 ENSP00000300738.5 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000300738.10Link to Ensembl Protein Viewer:ENSP00000300738.5Re-query CCDS DB by Nucleotide ID:ENST00000300738Re-query CCDS DB by Protein ID:ENSP00000300738
Original member Current member NCBI NM_001033.5 NP_001024.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_001033.5Link to Protein Sequence:NP_001024.1Re-query CCDS DB by Nucleotide ID:NM_001033Re-query CCDS DB by Protein ID:NP_001024Link to BLAST:NP_001024.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001024.1 792 P23921 792 100% 0 0

Chromosomal Locations for CCDS 7750.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 4095013 4095031 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4101993 4102081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4106046 4106223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4107435 4107535 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4109644 4109703 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4111601 4111640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4111900 4112062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4118320 4118461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4119845 4119928 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4121604 4121765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4122141 4122220 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4123183 4123384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4126684 4126833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4127035 4127256 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4129074 4129150 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4132286 4132421 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4133563 4133658 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4135082 4135270 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 4138195 4138383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2379 nt):
ATGCATGTGATCAAGCGAGATGGCCGCCAAGAACGAGTCATGTTTGACAAAATTACATCTCGAATCCAGA
AG
CTTTGTTATGGACTCAATATGGATTTTGTTGATCCTGCTCAGATCACCATGAAAGTAATCCAAGGCTT
G
TACAGTGGGGTCACCACAGTGGAACTAGATACTTTGGCTGCTGAAACAGCTGCAACCTTGACTACTAAG
CAC
CCTGACTATGCTATCCTGGCAGCCAGGATCGCTGTCTCTAACTTGCACAAAGAAACAAAGAAAGTGT
TC
AGTGATGTGATGGAAGACCTCTATAACTACATAAATCCACATAATGGCAAACACTCTCCCATGGTGGC
C
AAGTCAACATTGGATATTGTTCTGGCCAATAAAGATCGCCTGAATTCTGCTATTATCTATGACCGAGAT
TTC
TCTTACAATTACTTCGGCTTTAAGACGCTAGAGCGGTCTTATTTGTTGAAGATCAATGGAAAAGTGG
CT
GAAAGACCACAACATATGTTGATGAGAGTATCTGTTGGGATCCACAAAGAAGACATTGATGCAGCAAT
T
GAAACATATAATCTTCTTTCTGAGAGGTGGTTTACTCATGCTTCGCCCACTCTCTTCAATGCTGGTACC
AAC
CGCCCACAACTTTCTAGCTGTTTTCTTCTGAGTATGAAAGATGACAGCATTGAAGGCATTTATGACA
CT
CTAAAGCAATGTGCATTGATTTCTAAGTCTGCTGGAGGAATTGGTGTTGCTGTGAGTTGTATTCGGGC
T
ACTGGCAGCTACATTGCTGGGACTAATGGCAATTCCAATGGCCTTGTACCGATGCTGAGAGTATATAAC
AAC
ACAGCTCGATATGTGGATCAAGGTGGGAACAAGCGTCCTGGGGCATTTGCTATTTACCTGGAGCCTT
GG
CATTTAGACATCTTTGAATTCCTTGATTTAAAGAAGAACACAGGAAAGGAAGAGCAGCGTGCCAGAGA
T
CTTTTCTTTGCTCTTTGGATTCCGGATCTCTTCATGAAACGAGTGGAGACTAATCAGGACTGGTCTTTG
ATG
TGTCCAAATGAGTGTCCTGGTCTGGATGAGGTTTGGGGAGAGGAATTTGAGAAACTATATGCAAGTT
AT
GAGAAACAAGGTCGTGTCCGCAAAGTTGTAAAAGCTCAGCAGCTTTGGTATGCCATCATTGAGTCTCA
G
ACGGAAACAGGCACCCCGTATATGCTCTACAAAGATTCCTGTAATCGAAAGAGCAACCAGCAGAACCTG
GGA
ACCATCAAATGCAGCAACCTGTGCACAGAAATAGTGGAGTACACCAGCAAAGATGAGGTTGCTGTTT
GT
AATTTGGCTTCCCTGGCCCTGAATATGTATGTCACATCAGAACACACATACGACTTTAAGAAGTTGGC
T
GAAGTCACTAAAGTCGTTGTCCGAAACTTGAATAAAATTATTGATATAAACTACTATCCTGTACCAGAG
GCA
TGCCTATCAAATAAACGCCATCGCCCCATTGGAATTGGGGTACAAGGTCTGGCAGATGCTTTTATCC
TG
ATGAGATACCCTTTTGAGAGTGCAGAAGCCCAGTTACTGAATAAGCAGATCTTTGAAACTATTTATTA
T
GGTGCTCTGGAAGCCAGCTGTGACCTTGCCAAGGAGCAGGGCCCATACGAAACCTATGAGGGCTCTCCA
GTT
AGCAAAGGAATTCTTCAGTATGATATGTGGAATGTTACTCCTACAGACCTATGGGACTGGAAGGTTC
TC
AAGGAGAAGATTGCAAAGTATGGTATAAGAAACAGTTTACTTATTGCCCCGATGCCTACAGCTTCCAC
T
GCTCAGATCCTGGGGAATAATGAGTCCATTGAACCTTACACCAGCAACATCTATACTCGCAGAGTCTTG
TCA
GGAGAATTTCAGATTGTAAATCCTCACTTATTGAAAGATCTTACCGAGCGGGGCCTATGGCATGAAG
AG
ATGAAAAACCAGATTATTGCATGCAATGGCTCTATTCAGAGCATACCAGAAATTCCTGATGACCTGAA
G
CAACTTTATAAAACTGTGTGGGAAATCTCTCAGAAAACTGTTCTCAAGATGGCAGCTGAGAGAGGTGCT
TTC
ATTGATCAAAGCCAATCTTTGAACATCCACATTGCTGAGCCTAACTATGGCAAACTCACTAGTATGC
AC
TTCTACGGCTGGAAGCAGGGTTTGAAGACTGGGATGTATTATTTAAGGACAAGACCAGCGGCTAATCC
A
ATCCAGTTCACTCTAAATAAGGAGAAGCTAAAAGATAAAGAAAAGGTATCAAAAGAGGAAGAAGAGAAG
GAG
AGGAACACAGCAGCCATGGTGTGCTCTTTGGAGAATAGAGATGAATGTCTGATGTGTGGATCCTGA


Translation (792 aa):
MHVIKRDGRQERVMFDKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTK
H
PDYAILAARIAVSNLHKETKKVFS
DVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDRLNSAIIYDRD
F
SYNYFGFK
TLERSYLLKINGKVAERPQHMLMRVSVGIHKEDIDAAIETYNLLSERWFTHASPTLFNAGT
N
RPQLS
SCFLLSMKDDSIEGIYDTLKQCALISKSAGGIGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYN
N
TARYVDQGGNK
RPGAFAIYLEPWHLDIFEFLDLKKNTGKEEQRARDLFFALWIPDLFMKRVETNQDWSL
M
CPNECPGLDEVWGEEFEKLYA
SYEKQGRVRKVVKAQQLWYAIIESQTETGTPYMLYKDSCNRKSNQQNL
G
TIKCSNLCTEIVEYTSKDE
VAVCNLASLALNMYVTSEHTYDFKKLAEVTKVVVRNLNKIIDINYYPVPE
A
CLSNKRHRPIGIGVQGLADAFILMRYPFESAEAQLLNKQIFETIYYGALEASCDLAKEQGPYETYEGSP
V
SKG
ILQYDMWNVTPTDLWDWKVLKEKIAKYGIRNSLLIAPMPTASTAQILGNNESIEPYTSNIYTRRVL
S
GEFQ
IVNPHLLKDLTERGLWHEEMKNQIIACNGSIQSIPEIPDDLKQLYKTVWEISQKTVLKMAAERGA
F
IDQSQSLNIHIAEPNYGKLTSMHFYGWKQ
GLKTGMYYLRTRPAANPIQFTLNKEKLKDKEKVSKEEEEK
E
RNTAAMVCSLENRDECLMCGS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser