NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS77396.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
77396.1 Public Homo sapiens 2 CAD 22 109 92 CCDS HistoryNCBI Gene:790Re-query CCDS DB by CCDS ID:77396.1Re-query CCDS DB by GeneID:790See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 18, NCBI annotation release 107, Ensembl annotation release 79

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 77396.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000403525.5 ENSP00000384510.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000403525.5Link to Ensembl Protein Viewer:ENSP00000384510.1Re-query CCDS DB by Nucleotide ID:ENST00000403525Re-query CCDS DB by Protein ID:ENSP00000384510
Original member NCBI NM_001306079.1 NP_001293008.1 Updated not alive Link to Nucleotide Sequence:NM_001306079.1Link to Protein Sequence:NP_001293008.1Re-query CCDS DB by Nucleotide ID:NM_001306079Re-query CCDS DB by Protein ID:NP_001293008
Current member NCBI NM_001306079.2 NP_001293008.1 Accepted alive Link to Nucleotide Sequence:NM_001306079.2Link to Protein Sequence:NP_001293008.1Re-query CCDS DB by Nucleotide ID:NM_001306079Re-query CCDS DB by Protein ID:NP_001293008Link to BLAST:NP_001293008.1

Chromosomal Locations for CCDS 77396.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 27217552 27217633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27217877 27218016 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27221218 27221347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27222194 27222336 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27222519 27222660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27222866 27223037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27223563 27223748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27223917 27224029 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27224345 27224490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27224745 27224876 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27225010 27225243 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27225705 27225926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27226525 27226649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27226832 27226962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27231468 27231580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27231980 27232224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27232448 27232694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27233042 27233140 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27233312 27233536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27233626 27233808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27234008 27234226 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27234518 27234685 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27235245 27235427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27235536 27235640 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27236284 27236523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27236749 27236830 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27237379 27237545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27237718 27237882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27238056 27238187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27238431 27238632 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27239042 27239232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27239331 27239471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27239697 27239798 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27240265 27240361 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27240911 27240955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27241058 27241227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27241322 27241396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27241911 27242123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27242302 27242427 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27242620 27242775 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27242872 27242973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27243198 27243292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 27243416 27243518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (6489 nt):
ATGGCGGCCCTAGTGTTGGAGGACGGGTCGGTCCTGCGGGGCCAGCCCTTTGGGGCCGCCGTGTCGACTG
CC
GGGGAAGTGGTGTTTCAAACCGGCATGGTCGGCTACCCCGAGGCCCTCACTGATCCCTCCTACAAGGC
A
CAGATCTTAGTGCTCACCTATCCTCTGATCGGCAACTATGGCATCCCCCCAGATGAAATGGATGAGTTC
GGT
CTCTGCAAGTGGTTTGAATCCTCGGGCATCCACGTAGCAGCACTGGTAGTGGGAGAGTGCTGTCCTA
CT
CCCAGCCACTGGAGTGCCACCCGCACCCTGCATGAGTGGCTGCAGCAGCATGGCATCCCTGGCTTGCA
A
GGAGTAGACACTCGGGAGCTGACCAAGAAGTTGCGGGAACAGGGGTCTCTGCTGGGGAAGCTGGTCCAG
AAT
GGAACAGAACCTTCATCCCTGCCATTCTTGGACCCCAATGCCCGCCCCCTGGTACCAGAGGTCTCCA
TT
AAGACTCCACGGGTATTCAATACAGGGGGTGCCCCTCGGATCCTTGCTTTGGACTGTGGCCTCAAGTA
T
AATCAGATCCGATGCCTCTGCCAGCGTGGGGCTGAGGTCACTGTGGTACCCTGGGACCATGCACTAGAC
AGC
CAAGAGTATGAGGGTCTCTTCTTAAGTAATGGGCCTGGTGACCCTGCCTCCTATCCCAGTGTCGTAT
CC
ACACTGAGCCGTGTTTTATCTGAGCCTAATCCCCGACCTGTCTTTGGGATCTGCCTGGGACACCAGCT
A
TTGGCCTTAGCCATTGGGGCCAAGACTTACAAGATGAGATATGGGAACCGAGGCCATAACCAGCCCTGC
TTG
TTGGTGGGCTCTGGGCGCTGCTTTCTGACATCCCAGAACCATGGGTTTGCTGTGGAGACAGACTCAC
TG
CCAGCAGACTGGGCTCCTCTCTTCACCAACGCCAATGATGGTTCCAATGAAGGCATTGTGCACAACAG
C
TTGCCTTTCTTCAGTGTCCAGTTTCACCCAGAGCACCAAGCTGGCCCTTCAGATATGGAACTGCTTTTC
GAT
ATCTTTCTGGAAACTGTGAAAGAGGCCACAGCTGGGAACCCTGGGGGCCAGACAGTTAGAGAGCGGC
TG
ACTGAGCGCCTCTGTCCCCCTGGGATTCCCACTCCCGGCTCTGGACTTCCACCACCACGAAAGGTTCT
G
ATCCTGGGCTCAGGGGGCCTCTCCATTGGCCAAGCTGGAGAATTTGACTACTCGGGCTCTCAGGCAATT
AAG
GCCCTGAAGGAGGAAAACATCCAGACGTTGCTGATCAACCCCAATATTGCCACAGTGCAGACCTCCC
AG
GGGCTGGCCGACAAGGTCTATTTTCTTCCCATAACACCTCATTATGTAACCCAGGTGATACGTAATGA
A
CGCCCCGATGGTGTGTTACTGACTTTTGGGGGCCAGACTGCTCTGAACTGTGGTGTGGAGCTGACCAAG
GCC
GGGGTGCTGGCTCGGTATGGGGTCCGGGTCCTGGGCACACCAGTGGAGACCATTGAGCTGACCGAGG
AT
CGACGGGCCTTTGCTGCCAGAATGGCAGAGATCGGAGAGCATGTGGCCCCGAGCGAGGCAGCAAATTC
T
CTTGAACAGGCCCAGGCAGCCGCTGAACGGCTGGGGTACCCTGTGCTAGTGCGTGCAGCCTTTGCCCTG
GGT
GGCCTGGGCTCTGGCTTTGCCTCTAACAGGGAGGAGCTCTCTGCTCTCGTGGCCCCAGCTTTTGCCC
AT
ACCAGCCAAGTGCTAGTAGACAAGTCTCTGAAGGGATGGAAGGAGATTGAGTACGAGGTGGTGAGAGA
C
GCCTATGGCAACTGTGTCACGTATTACATCATTGAAGTGAATGCCAGGCTCTCTCGCAGCTCTGCCCTG
GCC
AGTAAGGCCACAGGTTATCCACTGGCTTATGTGGCAGCCAAGCTAGCATTGGGCATCCCTTTGCCTG
AG
CTCAGGAACTCTGTGACAGGGGGTACAGCAGCCTTTGAACCCAGCGTGGATTATTGTGTGGTGAAGAT
T
CCTCGATGGGACCTTAGCAAGTTCCTGCGAGTCAGCACAAAGATTGGGAGCTGCATGAAGAGCGTTGGT
GAA
GTCATGGGCATTGGGCGTTCATTTGAGGAGGCCTTCCAGAAGGCCCTGCGCATGGTGGATGAGAACT
GT
GTGGGCTTTGATCACACAGTGAAACCAGTCAGCGATATGGAGTTGGAGACTCCAACAGATAAGCGGAT
T
TTTGTGGTGGCAGCTGCTTTGTGGGCTGGTTATTCAGTGGACCGCCTGTATGAGCTCACACGCATCGAC
CGC
TGGTTCCTGCACCGAATGAAGCGTATCATCGCACATGCCCAGCTGCTAGAACAACACCGTGGACAGC
CT
TTGCCGCCAGACCTGCTGCAACAGGCCAAGTGTCTTGGCTTCTCAGACAAACAGATTGCCCTTGCAGT
T
CTGAGCACAGAGCTGGCTGTTCGCAAGCTGCGTCAGGAACTGGGGATCTGTCCAGCAGTGAAACAGATT
GAC
ACAGTTGCAGCTGAGTGGCCAGCCCAGACAAATTACCTATACCTAACGTATTGGGGCACCACCCATG
AC
CTCACCTTTCGAACACCTCATGTCCTAGTCCTTGGCTCTGGCGTCTACCGTATTGGCTCTAGCGTTGA
A
TTTGACTGGTGTGCTGTAGGCTGCATCCAGCAGCTCCGAAAGATGGGATATAAGACCATCATGGTGAAC
TAT
AACCCAGAGACAGTCAGCACCGACTATGACATGTGTGATCGACTCTACTTTGATGAGATCTCTTTTG
AG
GTGGTGATGGACATCTATGAGCTCGAGAACCCTGAAGGTGTGATCCTATCCATGGGTGGACAGCTGCC
C
AACAACATGGCCATGGCGTTGCATCGGCAGCAGTGCCGGGTGCTGGGCACCTCCCCTGAAGCCATTGAC
TCG
GCTGAGAACCGTTTCAAGTTTTCCCGGCTCCTTGACACCATTGGTATCAGCCAGCCTCAGTGGAGGG
AG
CTCAGTGACCTCGAGTCTGCTCGCCAATTCTGCCAGACCGTGGGGTACCCCTGTGTGGTGCGCCCCTC
C
TATGTGCTGAGCGGTGCTGCTATGAATGTGGCCTACACGGATGGAGACCTGGAGCGCTTCCTGAGCAGC
GCA
GCAGCCGTCTCCAAAGAGCATCCCGTGGTCATCTCCAAGTTCATCCAGGAGGCTAAGGAGATTGACG
TG
GATGCCGTGGCCTCTGATGGTGTGGTGGCAGCCATCGCCATCTCTGAGCATGTGGAGAATGCAGGTGT
G
CATTCAGGTGATGCGACGCTGGTGACCCCCCCACAAGATATCACTGCCAAAACCCTGGAGCGGATCAAA
GCC
ATTGTGCATGCTGTGGGCCAGGAGCTACAGGTCACAGGACCCTTCAATCTGCAGCTCATTGCCAAGG
AT
GACCAGCTGAAAGTTATTGAATGCAACGTACGTGTCTCTCGCTCCTTCCCCTTCGTTTCCAAGACACT
G
GGTGTGGACCTAGTAGCCTTGGCCACGCGGGTCATCATGGGGGAAGAAGTGGAACCTGTGGGGCTAATG
ACT
GGTTCTGGAGTCGTGGGAGTAAAGGTGCCTCAGTTCTCCTTCTCCCGCTTGGCGGGTGCTGACGTGG
TG
TTGGGTGTGGAAATGACCAGTACTGGGGAGGTGGCCGGCTTTGGGGAGAGCCGCTGTGAGGCATACCT
C
AAGGCCATGCTAAGCACTGGCTTTAAGATCCCCAAGAAGAATATCCTGCTGACCATTGGCAGCTATAAG
AAC
AAAAGCGAGCTGCTCCCAACTGTGCGGCTACTGGAGAGCCTGGGCTACAGCCTCTATGCCAGTCTCG
GC
ACAGCTGACTTCTACACTGAGCATGGCGTCAAGGTAACAGCTGTGGACTGGCACTTTGAGGAGGCTGT
G
GATGGTGAGTGCCCACCACAGCGGAGCATCCTGGAGCAGCTAGCTGAGAAAAACTTTGAGCTGGTGATT
AAC
CTGTCAATGCGTGGAGCTGGGGGCCGGCGTCTCTCTTCCTTTGTCACCAAGGGCTACCGCACCCGAC
GC
TTGGCCGCTGACTTCTCCGTGCCCCTAATCATCGATATCAAGTGCACCAAACTCTTTGTGGAGGCCCT
A
GGCCAGATCGGGCCAGCCCCTCCTTTGAAGGTGCATGTTGACTGTATGACCTCCCAAAAGCTTGTGCGA
CTG
CCGGGATTGATTGATGTCCATGTGCACCTGCGGGAACCAGGTGGGACACATAAGGAGGACTTTGCTT
CA
GGCACAGCCGCTGCCCTGGCTGGGGGTATCACCATGGTGTGTGCCATGCCTAATACCCGGCCCCCCAT
C
ATTGACGCCCCTGCTCTGGCCCTGGCCCAGAAGCTGGCAGAGGCTGGCGCCCGGTGCGACTTTGCGCTA
TTC
CTTGGGGCCTCGTCTGAAAATGCAGGAACCTTGGGCACCGTGGCCGGGTCTGCAGCCGGGCTGAAGC
TT
TACCTCAATGAGACCTTCTCTGAGCTGCGGCTGGACAGCGTGGTCCAGTGGATGGAGCATTTCGAGAC
A
TGGCCCTCCCACCTCCCCATTGTGGCTCACGCAGAGCAGCAAACCGTGGCTGCTGTCCTCATGGTGGCT
CAG
CTCACTCAGCGCTCAGTGCACATATGTCACGTGGCACGGAAGGAGGAGATCCTGCTAATTAAAGCTG
CA
AAGGCACGGGGCTTGCCAGTGACCTGCGAGGTGGCTCCCCACCACCTGTTCCTAAGCCATGATGACCT
G
GAGCGCCTGGGGCCTGGGAAGGGGGAGGTCCGGCCTGAGCTTGGCTCCCGCCAGGATGTGGAAGCCCTG
TGG
GAGAACATGGCTGTCATCGACTGCTTTGCCTCAGACCATGCTCCCCATACCTTGGAGGAGAAGTGTG
GG
TCCAGGCCCCCACCTGGGTTCCCAGGGTTAGAGACCATGCTGCCACTACTCCTGACGGCTGTAAGCGA
G
GGCCGGCTCAGCCTGGACGACCTGCTGCAGCGATTGCACCACAATCCTCGGCGCATCTTTCACCTGCCC
CCG
CAGGAGGACACCTATGTGGAGGTGGATCTGGAGCATGAGTGGACAATTCCCAGCCACATGCCCTTCT
CC
AAGGCCCACTGGACACCTTTTGAAGGGCAGAAAGTGAAGGGCACCGTCCGCCGTGTGGTCCTGCGAGG
G
GAGGTTGCCTATATCGATGGGCAGGTTCTGGTACCCCCGGGCTATGGACAGGATGTACGGAAGTGGCCA
CAG
GGGGCTGTTCCTCAGCTCCCACCCTCAGCCCCTGCCACTAGTGAGATGACCACGACACCTGAAAGAC
CC
CGCCGTGGCATCCCAGGGCTTCCTGATGGCCGCTTCCATCTGCCGCCCCGAATCCATCGAGCCTCCGA
C
CCAGGTTTGCCAGCTGAGGAGCCAAAGGAGAAGTCCTCTCGGAAGGTAGCCGAGCCAGAGCTGATGGGA
ACC
CCTGATGGCACCTGCTACCCTCCACCACCAGTACCGAGACAGGCATCTCCCCAGAACCTGGGGACCC
CT
GGCTTGCTGCACCCCCAGACCTCACCCCTGCTGCACTCATTAGTGGGCCAACATATCCTGTCCGTCCA
G
CAGTTCACCAAGGATCAGATGTCTCACCTGTTCAATGTGGCACACACACTGCGTATGATGGTGCAGAAG
GAG
CGGAGCCTCGACATCCTGAAGGGGAAGGTCATGGCCTCCATGTTCTATGAAGTGAGCACACGGACCA
GC
AGCTCCTTTGCAGCAGCCATGGCCCGGCTGGGAGGTGCTGTGCTCAGCTTCTCGGAAGCCACATCGTC
C
GTCCAGAAGGGCGAATCCCTGGCTGACTCCGTGCAGACCATGAGCTGCTATGCCGACGTCGTCGTGCTC
CGG
CACCCCCAGCCTGGAGCAGTGGAGCTGGCCGCCAAGCACTGCCGGAGGCCAGTGATCAATGCTGGGG
AT
GGGGTCGGAGAGCACCCCACCCAGGCCCTGCTGGACATCTTCACCATCCGTGAGGAGCTGGGAACTGT
C
AATGGCATGACGATCACGATGGTGGGTGACCTGAAGCACGGACGCACAGTACATTCCCTGGCCTGCCTG
CTC
ACCCAGTATCGTGTCAGCCTGCGCTACGTGGCACCTCCCAGCCTGCGCATGCCACCCACTGTGCGGG
CC
TTCGTGGCCTCCCGCGGCACCAAGCAGGAGGAATTCGAGAGCATTGAGGAGGCGCTGCCTGACACTGA
T
GTGCTCTACATGACTCGAATCCAGAAGGAACGATTTGGCTCTACCCAGGAGTACGAAGCTTGCTTTGGT
CAG
TTCATCCTCACTCCCCACATCATGACCCGGGCCAAGAAGAAGATGGTGGTGATGCACCCGATGCCCC
GT
GTCAACGAGATAAGCGTGGAAGTGGACTCGGATCCCCGCGCAGCCTACTTCCGCCAGGCTGAGAACGG
C
ATGTACATCCGCATGGCTCTGTTAGCCACCGTGCTGGGCCGTTTCTAG


Translation (2162 aa):
MAALVLEDGSVLRGQPFGAAVSTAGEVVFQTGMVGYPEALTDPSYKAQILVLTYPLIGNYGIPPDEMDEF
G
LCK
WFESSGIHVAALVVGECCPTPSHWSATRTLHEWLQQHGIPGLQGVDTRELTKKLREQGSLLGKLVQ
N
GTEPSSLPFLDPNARPLVPEVSIK
TPRVFNTGGAPRILALDCGLKYNQIRCLCQRGAEVTVVPWDHALD
S
Q
EYEGLFLSNGPGDPASYPSVVSTLSRVLSEPNPRPVFGICLGHQLLALAIGAKTYKMRYGNRGHNQPC
L
LVGSGRCFLTSQNHGFAVETDSLPADWAPLFTNANDGSNEGIVHNSLPFF
SVQFHPEHQAGPSDMELLF
D
IFLETVKEATAGNPGGQT
VRERLTERLCPPGIPTPGSGLPPPRKVLILGSGGLSIGQAGEFDYSGSQAI
K
ALKEENIQTLLINPNIATVQTSQGLADKVYFLPITPHYVTQ
VIRNERPDGVLLTFGGQTALNCGVELTK
A
GVLARYGVRVLGTPVETIELTEDRRAFAARMAEIGEHVAPSEAANSLEQ
AQAAAERLGYPVLVRAAFAL
G
GLGSGFASNREELSALVAPAFAHTSQVLVDKSLKGWKEIEYEVVRDAYGNCVT
YYIIEVNARLSRSSAL
A
SKATGYPLAYVAAKLALGIPLPEL
RNSVTGGTAAFEPSVDYCVVKIPRWDLSKFLRVSTKIGSCMKSVG
E
VMGIGRSFEEAFQKALRMVDENCVGFDHTVKPVSDM
ELETPTDKRIFVVAAALWAGYSVDRLYELTRID
R
WFLHRMKRIIAHAQLLEQHRGQPLPPDLLQQAKCLGFSDKQIALAVL
STELAVRKLRQELGICPAVKQI
D
TVAAEWPAQTNYLYLTYWGTTHDLTFRTPHVLVLGSGVYRIGSSVEFDWCAVGCIQQLRK
MGYKTIMVN
Y
NPETVSTDYDMCDRLYFDEISFE
VVMDIYELENPEGVILSMGGQLPNNMAMALHRQQCRVLGTSPEAID
S
AENRFKFSRLLDTIGISQPQWRELSDLE
SARQFCQTVGYPCVVRPSYVLSGAAMNVAYTDGDLERFLSS
A
AAVSKEHPVVISKFIQEAK
EIDVDAVASDGVVAAIAISEHVENAGVHSGDATLVTPPQDITAKTLERIK
A
IVHAVGQELQVTGPFNLQLIAK
DDQLKVIECNVRVSRSFPFVSKTLGVDLVALATRVIMGEEVEPVGLM
T
GSGVVGVK
VPQFSFSRLAGADVVLGVEMTSTGEVAGFGESRCEAYLKAMLSTGFKIPKKNILLTIGSYK
N
KSELLPTVRLLESLGYSLYASLGTADFYTEHGVK
VTAVDWHFEEAVDGECPPQRSILEQLAEKNFELVI
N
LSMRGAGGRRLSSFVTKGYRTRRLAADFSVPLIIDIKCTKLFVE
ALGQIGPAPPLKVHVDCMTSQKLVR
L
P
GLIDVHVHLREPGGTHKEDFASGTAAALAGGITMVCAMPNTRPPIIDAPALALAQKLAEAGARCDFAL
F
LGASSENAGTLGTVAGSAAGLKLYLNETFSELRLDSVVQWME
HFETWPSHLPIVAHAEQQTVAAVLMVA
Q
LTQRSVHICHVARKEE
ILLIKAAKARGLPVTCEVAPHHLFLSHDDLERLGPGKGEVRPELGSRQDVEAL
W
ENMAVIDCFASDH
APHTLEEKCGSRPPPGFPGLETMLPLLLTAVSEGRLSLDDLLQRLHHNPRRIFHLP
P
QEDTYVE
VDLEHEWTIPSHMPFSKAHWTPFEGQKVKGTVRRVVLRGEVAYIDGQVLVPPGYGQDVRKWP
Q
GAVPQLPPSAPATSEMTT
TPERPRRGIPGLPDGRFHLPPRIHRASDPGLPAEEPKEKSSRKVAEPELMG
T
PDGTCYPPPPVPRQASPQNLGTPGLLHPQTSPLLHSLVGQHILSVQQFTKDQ
MSHLFNVAHTLRMMVQK
E
RSLDILK
GKVMASMFYEVSTRTSSSFAAAMARLGGAVLSFSEATSSVQKGESLADSVQTMSCYADVVVL
R
HPQPGAVE
LAAKHCRRPVINAGDGVGEHPTQALLDIFTIREELGTVNGMTITMVGDLKHGRTVHSLACL
L
TQYRVSLRYVAPPSLRMPPTVRAFVASRGTKQ
EEFESIEEALPDTDVLYMTRIQKERFGSTQEYEACFG
Q
FILTPHIMTRAKKKMVVMHPMPRVNEI
SVEVDSDPRAAYFRQAENGMYIRMALLATVLGRF



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser