NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS77205.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
77205.1 Public Homo sapiens 19 CNN2 24 110 108 CCDS HistoryNCBI Gene:1265Re-query CCDS DB by CCDS ID:77205.1Re-query CCDS DB by GeneID:1265See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 18, NCBI annotation release 107, Ensembl annotation release 79

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 77205.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000562958.6 ENSP00000456436.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000562958.6Link to Ensembl Protein Viewer:ENSP00000456436.1Re-query CCDS DB by Nucleotide ID:ENST00000562958Re-query CCDS DB by Protein ID:ENSP00000456436
Original member Current member NCBI NM_001303501.2 NP_001290430.1 Accepted alive Link to Nucleotide Sequence:NM_001303501.2Link to Protein Sequence:NP_001290430.1Re-query CCDS DB by Nucleotide ID:NM_001303501Re-query CCDS DB by Protein ID:NP_001290430Link to BLAST:NP_001290430.1

Chromosomal Locations for CCDS 77205.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 1026662 1026724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1031071 1031192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1032392 1032458 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1032559 1032696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1036067 1036246 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1036416 1036562 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 1037625 1037900 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (993 nt):
ATGAGCTCCACGCAGTTCAACAAGGGCCCCTCGTACGGGCTGTCGGCCGAGGTCAAGAACCGGCTCCTGT
CC
AAATATGACCCCCAGAAGGAGGCAGAGCTCCGCACCTGGATCGAGGGACTCACCGGCCTCTCCATCGG
C
CCCGACTTCCAGAAGGGCCTGAAGGATGGAACTATCTTATGCACACTCATGAACAAGCTACAGCCGGGC
TCC
GTCCCCAAGATCAACCGCTCCATGCAGAACTGGCACCAGCTAGAAAACCTGTCCAACTTCATCAAGG
CC
ATGGTCAGCTACGGCATGAACCCTGTGGACCTGTTCGAGGCCAACGACCTGTTTGAGAGTGGGAACAT
G
ACGCAGGTGCAGGTGTCTCTTCTCGCCCTGGCGGGGAAGGGCCTAGATCTAGGGTCCCTGGCTGCCCTC
TGC
TGGTACTCCCGGCCCCTTTCCCTCACCCAGGCCAAGACTAAGGGGCTGCAGAGCGGGGTGGACATTG
GC
GTCAAGTACTCGGAGAAGCAGGAGCGGAATTTCGACGATGCCACCATGAAGGCTGGCCAGTGCGTCAT
C
GGGCTGCAGATGGGCACCAACAAATGCGCCAGCCAGTCGGGCATGACTGCCTACGGCACGAGAAGGCAT
CTC
TATGACCCCAAGAACCATATCCTGCCCCCCATGGACCACTCGACCATCAGCCTCCAGATGGGCACGA
AC
AAGTGTGCCAGCCAGGTGGGCATGACGGCTCCCGGGACCCGGCGGCACATCTATGATACCAAGCTGGG
A
ACCGACAAGTGTGACAACTCCTCCATGTCCCTGCAGATGGGCTACACGCAGGGCGCCAACCAGAGCGGC
CAG
GTCTTCGGCCTGGGCCGGCAGATATATGACCCCAAGTACTGCCCGCAAGGCACAGTGGCCGATGGGG
CT
CCCTCGGGCACCGGCGACTGCCCGGACCCGGGGGAGGTCCCTGAATATCCCCCTTACTACCAGGAGGA
G
GCCGGCTACTGA


Translation (330 aa):
MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILCTLMNKLQPG
S
VPKINRSMQNWHQ
LENLSNFIKAMVSYGMNPVDLFEANDLFESGNMTQVQVSLLALAGKGLDLGSLAAL
C
WYSRPLSLTQAKTKGLQSGVDIGVKYSEKQERNFDDATMKAGQCVIGLQ
MGTNKCASQSGMTAYGTRRH
L
YDPKNHILPPMDHSTISLQMGTNKCASQ
VGMTAPGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSG
Q
VFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser