NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Tuesday, June 25, 2024, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS7712.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7712.1 Public Homo sapiens 11 TALDO1 24 110 108 CCDS HistoryNCBI Gene:6888Re-query CCDS DB by CCDS ID:7712.1Re-query CCDS DB by GeneID:6888See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7712.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000319006.8 ENSP00000321259.3 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000319006.8Link to Ensembl Protein Viewer:ENSP00000321259.3Re-query CCDS DB by Nucleotide ID:ENST00000319006Re-query CCDS DB by Protein ID:ENSP00000321259
Original member Current member NCBI NM_006755.2 NP_006746.1 MANE Select Accepted alive Link to Nucleotide Sequence:NM_006755.2Link to Protein Sequence:NP_006746.1Re-query CCDS DB by Nucleotide ID:NM_006755Re-query CCDS DB by Protein ID:NP_006746Link to BLAST:NP_006746.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006746.1 337 P37837-1 337 100% 0 0

Chromosomal Locations for CCDS 7712.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 747482 747578 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 755879 756002 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 758950 759057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 760122 760253 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 763344 763519 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 763747 763944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 764288 764433 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 764813 764845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1014 nt):
ATGTCGAGCTCACCCGTGAAGCGTCAGAGGATGGAGTCCGCGCTGGACCAGCTCAAGCAGTTCACCACCG
TG
GTGGCCGACACGGGCGACTTCCACGCCATCGACGAGTACAAGCCCCAGGATGCTACCACCAACCCGTC
C
CTGATCCTGGCCGCAGCACAGATGCCCGCTTACCAGGAGCTGGTGGAGGAGGCGATTGCCTATGGCCGG
AAG
CTGGGCGGGTCACAAGAGGACCAGATTAAAAATGCTATTGATAAACTTTTTGTGTTGTTTGGAGCAG
AA
ATACTAAAGAAGATTCCGGGCCGAGTATCCACAGAAGTAGACGCAAGGCTCTCCTTTGATAAAGATGC
G
ATGGTGGCCAGAGCCAGGCGGCTCATCGAGCTCTACAAGGAAGCTGGGATCAGCAAGGACCGAATTCTT
ATA
AAGCTGTCATCAACCTGGGAAGGAATTCAGGCTGGAAAGGAGCTCGAGGAGCAGCACGGCATCCACT
GC
AACATGACGTTACTCTTCTCCTTCGCCCAGGCTGTGGCCTGTGCCGAGGCGGGTGTGACCCTCATCTC
C
CCATTTGTTGGGCGCATCCTTGATTGGCATGTGGCAAACACCGACAAGAAATCCTATGAGCCCCTGGAA
GAC
CCTGGGGTAAAGAGTGTCACTAAAATCTACAACTACTACAAGAAGTTTAGCTACAAAACCATTGTCA
TG
GGCGCCTCCTTCCGCAACACGGGCGAGATCAAAGCACTGGCCGGCTGTGACTTCCTCACCATCTCACC
C
AAGCTCCTGGGAGAGCTGCTGCAGGACAACGCCAAGCTGGTGCCTGTGCTCTCAGCCAAGGCGGCCCAA
GCC
AGTGACCTGGAAAAAATCCACCTGGATGAGAAGTCTTTCCGTTGGTTGCACAACGAGGACCAGATGG
CT
GTGGAGAAGCTCTCTGACGGGATCCGCAAGTTTGCCGCTGATGCAGTGAAGCTGGAGCGGATGCTGAC
A
GAACGAATGTTCAATGCAGAGAATGGAAAGTAG


Translation (337 aa):
MSSSPVKRQRMESALDQLKQFTTVVADTGDFHAIDEYKPQDATTNPSLILAAAQMPAYQELVEEAIAYGR
K
LG
GSQEDQIKNAIDKLFVLFGAEILKKIPGRVSTEVDARLSFDKDAMVARARRLIELYKEAGISKDRIL
I
KLSSTWEGIQAG
KELEEQHGIHCNMTLLFSFAQAVACAEAGVTLISPFVGRILDWHVANTDKKSYEPLE
D
P
GVKSVTKIYNYYKKFSYKTIVMGASFRNTGEIKALAGCDFLTISPKLLGELLQDNAKLVPVLSAKAAQ
A
SDLEKIHLDEKSFRWLHNEDQMAVEKLSDGIRKFAADAVKLERMLT
ERMFNAENGK



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser