NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS76737.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
76737.1 Public Homo sapiens 15 GANC 22 109 92 CCDS HistoryNCBI Gene:2595Re-query CCDS DB by CCDS ID:76737.1Re-query CCDS DB by GeneID:2595See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 18, NCBI annotation release 107, Ensembl annotation release 79

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 76737.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000440615.6 ENSP00000399557.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000440615.6Link to Ensembl Protein Viewer:ENSP00000399557.2Re-query CCDS DB by Nucleotide ID:ENST00000440615Re-query CCDS DB by Protein ID:ENSP00000399557
Original member NCBI NM_001301410.1 NP_001288339.1 Updated not alive Link to Nucleotide Sequence:NM_001301410.1Link to Protein Sequence:NP_001288339.1Re-query CCDS DB by Nucleotide ID:NM_001301410Re-query CCDS DB by Protein ID:NP_001288339
Current member NCBI NM_001301410.2 NP_001288339.1 Accepted alive Link to Nucleotide Sequence:NM_001301410.2Link to Protein Sequence:NP_001288339.1Re-query CCDS DB by Nucleotide ID:NM_001301410Re-query CCDS DB by Protein ID:NP_001288339Link to BLAST:NP_001288339.1

Chromosomal Locations for CCDS 76737.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 42274482 42274510 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42276348 42276410 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42278482 42278590 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42280917 42281133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 42283611 42284041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (849 nt):
ATGGAAGCAGCAGTGAAAGAGGAAATAAGTCTTGAAGATGAAGCTGTAGATAAAAACATTTTCAGAGACT
GT
AACAAGATCGCATTTTACAGGCGTCAGAAACAGTGGCTTTCCAAGAAGTCCACCTATCAGGCATTATT
G
GATTCAGTCACAACAGATGAAGACAGCACCAGGTTCCAAATCATCAATGAAGCAAGTAAGGTCAGGTGC
CAG
GACCAGAGCCCAACAACTCTGGATGCCTTCAAAGGCAAAGAAACCACAGTCCAGGAGGAGACACAGG
AT
CTCAGCACAAGACAGCACCTGGCTCAAAAGGAAGCTGAGGAGCCTGATAAACAAGGACAAATTACCTG
G
GACATCAGCAACGTAGCTCCCAAGACTGAGAACTTTGAGGACCTCTTGGAACAAACTCCATGCTCAGCC
TGT
TTGCAAGGTTTCACCAGAGACAACACTTCCAGCAGCTTCTCCGAGGATGCAGGAATATCTCTGAGCA
CC
TCTGTGAAGTTACCCCTTGCCTCTTCATCTAAGCCTAATGAAAATGAAGCTTTGCCCAACCAGCCACC
T
TCTCAGCAGATAAGGCACAACTACCGCTTATTAGCCAGTACTGTGTCTGCAGAAATGGCCAGGAACAGG
CAG
CTAATTTGGGAACTGGCCAGACAATCAGAAGCACACCTGGACAGGCCAGTTGTCCTTGGGGAACAGG
CC
AGTGCCCAGCGTGAGGTTGCCAGTATTCTTTGTAGAAAATCAGTGCTTGCAATAAACCAACTGGCTGC
A
ACTGTAGAAGGGACAATTAGTGTCCTACAGCAATTTAATGAACTATTAGACCATCCTCTGGATCCCGGG
AGG
TCTTGA


Translation (282 aa):
MEAAVKEEISLEDEAVDKNIFRDCNKIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQIINEASKVRC
Q
DQSPTTLDAFKGKETTVQEETQDLSTRQHLAQKEAEEPDKQGQITWDISNVAPKTENFEDLLEQTPCS
A
C
LQGFTRDNTSSSFSEDAGISLSTSVKLPLASSSKPNENEALPNQPPSQQIRHNYRLLASTVSAEMARNR
Q
LIWELARQSEAHLDRPVVLGEQASAQREVASILCRKSVLAINQLAATVEGTISVLQQFNELLDHPLDPG
R
S




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser