NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS76706.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
76706.1 Public Homo sapiens 14 ACYP1 22 109 92 CCDS HistoryNCBI Gene:97Re-query CCDS DB by CCDS ID:76706.1Re-query CCDS DB by GeneID:97See the combined annotation on chromosome 14 in Sequence Viewer

Public since: CCDS release 18, NCBI annotation release 107, Ensembl annotation release 79

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 76706.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000555463.1 ENSP00000450873.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000555463.1Link to Ensembl Protein Viewer:ENSP00000450873.1Re-query CCDS DB by Nucleotide ID:ENST00000555463Re-query CCDS DB by Protein ID:ENSP00000450873
Original member NCBI NM_001302617.1 NP_001289546.1 Updated not alive Link to Nucleotide Sequence:NM_001302617.1Link to Protein Sequence:NP_001289546.1Re-query CCDS DB by Nucleotide ID:NM_001302617Re-query CCDS DB by Protein ID:NP_001289546
Current member NCBI NM_001302617.2 NP_001289546.1 Accepted alive Link to Nucleotide Sequence:NM_001302617.2Link to Protein Sequence:NP_001289546.1Re-query CCDS DB by Nucleotide ID:NM_001302617Re-query CCDS DB by Protein ID:NP_001289546Link to BLAST:NP_001289546.1

Chromosomal Locations for CCDS 76706.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 14 (NC_000014.9)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14See the combined annotation on chromosome 14 in Sequence Viewer

Chromosome Start Stop Links
14 75053444 75053659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 75063470 75063561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14
14 75069210 75069291 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 14Link to Ensembl Genome Browser on chromosome 14

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (390 nt):
ATGCCGGCGTCCGCCCGCCTGGCGGGAGCGGGGCTGCTGCTGGCCTTTCTCCGCGCGCTCGGCTGCGCTG
GG
CGGGCCCCAGGTTTGAGCATGGCAGAAGGAAACACCCTGATATCAGTGGATTATGAAATTTTTGGGAA
G
GTGCAAGGGGTGTTTTTCCGTAAGCATACTCAGGCTGAGGGTAAAAAGCTGGGATTGGTAGGCTGGGTC
CAG
AACACTGACCGGGGCACAGTGCAAGGACAATTGCAAGGTCCCATCTCCAAGGTGCGTCATATGCAGG
AA
TGGCTTGAAACAAGAGGAAGTCCTAAATCACACATCGACAAAGCAAACTTCAACAATGAAAAAGTCAT
C
TTGAAGTTGGATTACTCAGACTTCCAAATTGTAAAATAA


Translation (129 aa):
MPASARLAGAGLLLAFLRALGCAGRAPGLSMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWV
Q
NTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser