NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS7669.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7669.2 Public Homo sapiens 10 INPP5A 22 109 92 CCDS HistoryNCBI Gene:3632Re-query CCDS DB by CCDS ID:7669.2Re-query CCDS DB by GeneID:3632See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 7669.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000368594.7 ENSP00000357583.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000368594.7Link to Ensembl Protein Viewer:ENSP00000357583.3Re-query CCDS DB by Nucleotide ID:ENST00000368594Re-query CCDS DB by Protein ID:ENSP00000357583
Original member NCBI NM_005539.4 NP_005530.3 Updated not alive Link to Nucleotide Sequence:NM_005539.4Link to Protein Sequence:NP_005530.3Re-query CCDS DB by Nucleotide ID:NM_005539Re-query CCDS DB by Protein ID:NP_005530
Current member NCBI NM_005539.5 NP_005530.3 Accepted alive Link to Nucleotide Sequence:NM_005539.5Link to Protein Sequence:NP_005530.3Re-query CCDS DB by Nucleotide ID:NM_005539Re-query CCDS DB by Protein ID:NP_005530Link to BLAST:NP_005530.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005530.3 412 Q14642 412 100% 0 0

Chromosomal Locations for CCDS 7669.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 132538097 132538171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132607915 132607956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132645868 132645968 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132650418 132650505 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132690392 132690455 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132697816 132697919 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132708313 132708365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132710337 132710456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132726821 132726905 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132749517 132749612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132749771 132749845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132765773 132765846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132777671 132777782 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132780849 132780917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 132781861 132781941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1239 nt):
ATGGCGGGGAAGGCGGCCGCCCCGGGCACCGCGGTGCTGCTGGTCACGGCCAACGTGGGCTCGCTCTTCG
AC
GACCCAGAAAACCTGCAGAAGAACTGGCTTCGGGAATTTTACCAGGTCGTGCACACACACAAGCCGCA
C
TTCATGGCCTTGCACTGTCAGGAGTTTGGAGGGAAGAACTACGAGGCCTCCATGTCCCACGTGGACAAG
TTC
GTCAAAGAACTATTGTCGAGTGATGCGATGAAAGAATATAACAGGGCTCGAGTCTACCTGGATGAAA
AC
TACAAATCCCAGGAGCACTTCACGGCACTAGGAAGCTTTTATTTTCTTCATGAGTCCTTAAAAAACAT
C
TACCAGTTTGACTTTAAAGCTAAGAAGTATAGAAAGGTCGCTGGCAAAGAGATCTACTCGGATACCTTA
GAG
AGCACGCCCATGCTGGAGAAGGAGAAGTTTCCGCAGGACTACTTCCCCGAGTGCAAATGGTCAAGAA
AA
GGCTTCATCCGGACGAGGTGGTGCATTGCAGACTGTGCCTTTGACTTGGTGAATATCCATCTTTTCCA
T
GATGCTTCCAATCTGGTCGCCTGGGAAACAAGCCCTTCCGTGTACTCGGGAATCCGGCACAAGGCACTG
GGC
TACGTGCTGGACAGAATCATTGATCAGCGATTCGAGAAGGTTTCCTACTTTGTATTTGGTGATTTCA
AC
TTCCGGCTGGATTCCAAGTCCGTCGTGGAGACGCTCTGCACAAAAGCCACCATGCAGACGGTCCGGGC
C
GCCGACACCAATGAAGTGGTGAAGCTCATATTTCGTGAGTCGGACAACGACCGGAAGGTTATGCTCCAG
TTA
GAAAAGAAACTCTTCGACTACTTCAACCAGGAGGTTTTCCGAGACAACAACGGCACCGCGCTCTTGG
AG
TTTGACAAGGAGTTGTCTGTCTTTAAGGACAGACTGTATGAACTGGACATCTCGTTCCCTCCCAGCTA
C
CCGTACAGTGAGGACGCCCGCCAGGGTGAGCAGTACATGAACACCCGGTGCCCAGCCTGGTGTGACCGC
ATC
CTCATGTCCCCGTCTGCCAAGGAGCTGGTGCTGCGGTCGGAGAGCGAGGAGAAGGTTGTCACCTATG
AC
CACATTGGGCCCAACGTCTGCATGGGAGACCACAAGCCCGTGTTCCTGGCCTTCCGAATCATGCCCGG
G
GCAGGTAAACCTCATGCCCATGTGCACAAGTGTTGTGTCGTGCAGTGA


Translation (412 aa):
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDK
F
V
KELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTL
E
STPMLEKEKFPQDYFPE
CKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKAL
G
YVLD
RIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQ
L
EKKLFDYFNQEVFRDNNGTA
LLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDR
I
LMSPSAKELVLR
SESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser