NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS76643.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
76643.1 Public Homo sapiens 13 ABCC4 22 109 92 CCDS HistoryNCBI Gene:10257Re-query CCDS DB by CCDS ID:76643.1Re-query CCDS DB by GeneID:10257See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 18, NCBI annotation release 107, Ensembl annotation release 79

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 76643.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000536256.3 ENSP00000442024.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000536256.3Link to Ensembl Protein Viewer:ENSP00000442024.1Re-query CCDS DB by Nucleotide ID:ENST00000536256Re-query CCDS DB by Protein ID:ENSP00000442024
Original member NCBI NM_001301830.1 NP_001288759.1 Updated not alive Link to Nucleotide Sequence:NM_001301830.1Link to Protein Sequence:NP_001288759.1Re-query CCDS DB by Nucleotide ID:NM_001301830Re-query CCDS DB by Protein ID:NP_001288759
Current member NCBI NM_001301830.2 NP_001288759.1 Accepted alive Link to Nucleotide Sequence:NM_001301830.2Link to Protein Sequence:NP_001288759.1Re-query CCDS DB by Nucleotide ID:NM_001301830Re-query CCDS DB by Protein ID:NP_001288759Link to BLAST:NP_001288759.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001288759.1 784 O15439-4 784 100% 0 0

Chromosomal Locations for CCDS 76643.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 13 (NC_000013.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 95096135 95096179 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95115922 95116001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95161189 95161335 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95163122 95163216 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95163610 95163647 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95164378 95164518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95166158 95166367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95170532 95170628 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95177707 95177793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95177997 95178091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95186701 95186892 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95188453 95188542 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95194836 95194937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95206532 95206781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95207800 95207925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95209434 95209597 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95210692 95210781 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95246975 95247095 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95247643 95247753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 95301241 95301314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2355 nt):
ATGCTGCCCGTGTACCAGGAGGTGAAGCCCAACCCGCTGCAGGACGCGAACCTCTGCTCACGCGTGTTCT
TC
TGGTGGCTCAATCCCTTGTTTAAAATTGGCCATAAACGGAGATTAGAGGAAGATGATATGTATTCAGT
G
CTGCCAGAAGACCGCTCACAGCACCTTGGAGAGGAGTTGCAAGGGTTCTGGGATAAAGAAGTTTTAAGA
GCT
GAGAATGACGCACAGAAGCCTTCTTTAACAAGAGCAATCATAAAGTGTTACTGGAAATCTTATTTAG
TT
TTGGGAATTTTTACGTTAATTGAGGCACTTCGTCTTAGTAACATGGCCATGGGGAAGACAACCACAGG
C
CAGATAGTCAATCTGCTGTCCAATGATGTGAACAAGTTTGATCAGGTGACAGTGTTCTTACACTTCCTG
TGG
GCAGGACCACTGCAGGCGATTGCAGTGACTGCCCTACTCTGGATGGAGATAGGAATATCGTGCCTTG
CT
GGGATGGCAGTTCTAATCATTCTCCTGCCCTTGCAAAGCTGTTTTGGGAAGTTGTTCTCATCACTGAG
G
AGTAAAACTGCAACTTTCACGGATGCCAGGATCAGGACCATGAATGAAGTTATAACTGGTATAAGGATA
ATA
AAAATGTACGCCTGGGAAAAGTCATTTTCAAATCTTATTACCAATTTGAGAAAGAAGGAGATTTCCA
AG
ATTCTGAGAAGTTCCTGCCTCAGAGGGATGAATTTGGCTTCATTTTTCAGTGCAAGCAAAATCATCGT
G
TTTGTGACCTTCACCACCTACGTGCTCCTCGGCAGTGTGATCACAGCCAGCCGCGTGTTCGTGGCAGTG
ACG
CTGTATGGGGCTGTGCGGCTGACGGTTACCCTCTTCTTCCCCTCAGCCATTGAGAGGGTGTCAGAGG
CA
ATCGTCAGCATCCGAAGAATCCAGACCTTTTTGCTACTTGATGAGATATCACAGCGCAACCGTCAGCT
G
CCGTCAGATGGTAAAAAGATGGTGCATGTGCAGGATTTTACTGCTTTTTGGGATAAGGCATCAGAGACC
CCA
ACTCTACAAGGCCTTTCCTTTACTGTCAGACCTGGCGAATTGTTAGCTGTGGTCGGCCCCGTGGGAG
CA
GGGAAGTCATCACTGTTAAGTGCCGTGCTCGGGGAATTGGCCCCAAGTCACGGGCTGGTCAGCGTGCA
T
GGAAGAATTGCCTATGTGTCTCAGCAGCCCTGGGTGTTCTCGGGAACTCTGAGGAGTAATATTTTATTT
GGG
AAGAAATACGAAAAGGAACGATATGAAAAAGTCATAAAGGCTTGTGCTCTGAAAAAGGATTTACAGC
TG
TTGGAGGATGGTGATCTGACTGTGATAGGAGATCGGGGAACCACGCTGAGTGGAGGGCAGAAAGCACG
G
GTAAACCTTGCAAGAGCAGTGTATCAAGATGCTGACATCTATCTCCTGGACGATCCTCTCAGTGCAGTA
GAT
GCGGAAGTTAGCAGACACTTGTTCGAACTGTGTATTTGTCAAATTTTGCATGAGAAGATCACAATTT
TA
GTGACTCATCAGTTGCAGTACCTCAAAGCTGCAAGTCAGATTCTGATATTGAAAGATGGTAAAATGGT
G
CAGAAGGGGACTTACACTGAGTTCCTAAAATCTGGTATAGATTTTGGCTCCCTTTTAAAGAAGGATAAT
GAG
GAAAGTGAACAACCTCCAGTTCCAGGAACTCCCACACTAAGGAATCGTACCTTCTCAGAGTCTTCGG
TT
TGGTCTCAACAATCTTCTAGACCCTCCTTGAAAGATGGTGCTCTGGAGAGCCAAGATACAGAGAATGT
C
CCAGTTACACTATCAGAGGAGAACCGTTCTGAAGGAAAAGTTGGTTTTCAGGCCTATAAGAATTACTTC
AGA
GCTGGTGCTCACTGGATTGTCTTCATTTTCCTTATTCTCCTAAACACTGCAGCTCAGGTTGCCTATG
TG
CTTCAAGATTGGTGGCTTTCATACTGGGCAAACAAACAAAGTATGCTAAATGTCACTGTAAATGGAGG
A
GGAAATGTAACCGAGAAGCTAGATCTTAACTGGTACTTAGGAATTTATTCAGGTTTAACTGTAGCTACC
GTT
CTTTTTGGCATAGCAAGATCTCTATTGGTATTCTACGTCCTTGTTAACTCTTCACAAACTTTGCACA
AC
AAAATGTTTGAGTCAATTCTGAAAGCTCCGGTATTATTCTTTGATAGAAATCCAATAGGAAGAATTTT
A
AATCGTTTCTCCAAAGACATTGGACACTTGGATGATTTGCTGCCGCTGACGTTTTTAGATTTCATCCAG
AGA
TGGGATCTCGCTGTGTTGTCCTGGCTGGTCTCAAACTCCTAG


Translation (784 aa):
MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLR
A
ENDAQKPSLTRAIIKCYWKSYLVLGIFTLIE
ALRLSNMAMGKTTTGQIVNLLSNDVNKFDQVTVFLHFL
W
AGPLQAIAVTALLWMEIGISCLAGMAVLIILLPLQSCFGKLFSSL
RSKTATFTDARIRTMNEVITGIRI
I
KMYAWEKSFSNLITNLR
KKEISKILRSSCLRGMNLASFFSASKIIVFVTFTTYVLLGSVITASRVFVAV
T
LYGAVRLTVTLFFPSAIERVSEAIVSIRRIQ
TFLLLDEISQRNRQLPSDGKKMVHVQDFTAFWDKASET
P
TLQGLSFTVRPGELLAVVGPVGAGK
SSLLSAVLGELAPSHGLVSVHGRIAYVSQQPWVFSGTLRSNILF
G
KKYEKERYEKVIKACALKK
DLQLLEDGDLTVIGDRGTTLSGGQKARVNLARAVYQDADIYLLDDPLSAV
D
AEVSRHLFE
LCICQILHEKITILVTHQLQYLKAASQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKDN
E
ESEQPPVPGTPTLRNRTFSESSVWSQQSSRPSLKDGALESQD
TENVPVTLSEENRSEGKVGFQAYKNYF
R
AGAHWIVFIFLILLNTAAQ
VAYVLQDWWLSYWANKQSMLNVTVNGGGNVTEKLDLNWYLGIYSGLTVAT
V
LFGIARSLLVFYVLVNSSQTLHNKMFESILKAPVLFFDRNPI
GRILNRFSKDIGHLDDLLPLTFLDFIQ
R
WDLAVLSWLVSNS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser