NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS75727.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
75727.1 Public Homo sapiens 8 NRG1 22 109 92 CCDS HistoryNCBI Gene:3084Re-query CCDS DB by CCDS ID:75727.1Re-query CCDS DB by GeneID:3084See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 75727.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000539990.3 ENSP00000439276.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000539990.3Link to Ensembl Protein Viewer:ENSP00000439276.2Re-query CCDS DB by Nucleotide ID:ENST00000539990Re-query CCDS DB by Protein ID:ENSP00000439276
Original member NCBI NM_001159996.2 NP_001153468.1 Updated not alive Link to Nucleotide Sequence:NM_001159996.2Link to Protein Sequence:NP_001153468.1Re-query CCDS DB by Nucleotide ID:NM_001159996Re-query CCDS DB by Protein ID:NP_001153468
Current member NCBI NM_001159996.3 NP_001153468.1 Accepted alive Link to Nucleotide Sequence:NM_001159996.3Link to Protein Sequence:NP_001153468.1Re-query CCDS DB by Nucleotide ID:NM_001159996Re-query CCDS DB by Protein ID:NP_001153468Link to BLAST:NP_001153468.1

Chromosomal Locations for CCDS 75727.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 32722003 32722042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32727949 32728078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32742008 32742075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32754372 32754474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32756403 32756529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32759306 32759436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32760200 32760406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32763218 32763338 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (927 nt):
ATGCAGATTCCTAAACACATAAGCATTGAAGATATTACAGCTACATCTACATCCACCACTGGGACAAGCC
AT
CTTGTAAAATGTGCGGAGAAGGAGAAAACTTTCTGTGTGAATGGAGGGGAGTGCTTCATGGTGAAAGA
C
CTTTCAAACCCCTCGAGATACTTGTGCAAGTGCCAACCTGGATTCACTGGAGCAAGATGTACTGAGAAT
GTG
CCCATGAAAGTCCAAAACCAAGAAAAGGCGGAGGAGCTGTACCAGAAGAGAGTGCTGACCATAACCG
GC
ATCTGCATCGCCCTCCTTGTGGTCGGCATCATGTGTGTGGTGGCCTACTGCAAAACCAAGAAACAGCG
G
AAAAAGCTGCATGACCGTCTTCGGCAGAGCCTTCGGTCTGAACGAAACAATATGATGAACATTGCCAAT
GGG
CCTCACCATCCTAACCCACCCCCCGAGAATGTCCAGCTGGTGAATCAATACGTATCTAAAAACGTCA
TC
TCCAGTGAGCATATTGTTGAGAGAGAAGCAGAGACATCCTTTTCCACCAGTCACTATACTTCCACAGC
C
CATCACTCCACTACTGTCACCCAGACTCCTAGCCACAGCTGGAGCAACGGACACACTGAAAGCATCCTT
TCC
GAAAGCCACTCTGTAATCGTGATGTCATCCGTAGAAAACAGTAGGCACAGCAGCCCAACTGGGGGCC
CA
AGAGGACGTCTTAATGGCACAGGAGGCCCTCGTGAATGTAACAGCTTCCTCAGGCATGCCAGAGAAAC
C
CCTGATTCCTACCGAGACTCTCCTCATAGTGAAAGACATAACCTTATAGCTGAGCTAAGGAGAAACAAG
GCA
CACAGATCCAAATGCATGCAGATCCAGCTATCAGCAACTCATCTTAGATCTTCTTCCATTCCCCATT
TG
GGCTTCATTCTCTAA


Translation (308 aa):
MQIPKHISIEDITATSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCQPGFTGARCTEN
V
PMKVQNQE
KAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQSLRSERNNMMNIAN
G
PHHPNPPPENVQLVN
QYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQTPSHSWSNGHTESIL
S
ESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPHSE
RHNLIAELRRNK
A
HRSKCMQIQLSATHLRSSSIPHLGFIL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser