NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS7556.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7556.1 Public Homo sapiens 10 GSTO2 22 109 92 CCDS HistoryNCBI Gene:119391Re-query CCDS DB by CCDS ID:7556.1Re-query CCDS DB by GeneID:119391See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7556.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000338595.6 ENSP00000345023.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000338595.6Link to Ensembl Protein Viewer:ENSP00000345023.1Re-query CCDS DB by Nucleotide ID:ENST00000338595Re-query CCDS DB by Protein ID:ENSP00000345023
Original member NCBI NM_183239.1 NP_899062.1 Updated not alive Link to Nucleotide Sequence:NM_183239.1Link to Protein Sequence:NP_899062.1Re-query CCDS DB by Nucleotide ID:NM_183239Re-query CCDS DB by Protein ID:NP_899062
Current member NCBI NM_183239.2 NP_899062.1 Accepted alive Link to Nucleotide Sequence:NM_183239.2Link to Protein Sequence:NP_899062.1Re-query CCDS DB by Nucleotide ID:NM_183239Re-query CCDS DB by Protein ID:NP_899062Link to BLAST:NP_899062.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_899062.1 243 Q9H4Y5-1 243 100% 0 0

Chromosomal Locations for CCDS 7556.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 104274916 104274949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 104275226 104275334 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 104277894 104278116 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 104279370 104279471 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 104297578 104297684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 104299128 104299284 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (732 nt):
ATGTCTGGGGATGCGACCAGGACCCTGGGGAAAGGAAGCCAGCCCCCAGGGCCAGTCCCGGAGGGGCTGA
TC
CGCATCTACAGCATGAGGTTCTGCCCCTATTCTCACAGGACCCGCCTCGTCCTCAAGGCCAAAGACAT
C
AGACATGAAGTGGTCAACATTAACCTGAGAAACAAGCCTGAATGGTACTATACAAAGCACCCTTTTGGC
CAC
ATTCCTGTCCTGGAGACCAGCCAATGTCAACTGATCTATGAATCTGTTATTGCTTGTGAGTACCTGG
AT
GATGCTTATCCAGGAAGGAAGCTGTTTCCATATGACCCTTATGAACGAGCTCGCCAAAAGATGTTATT
G
GAGCTATTTTGTAAGGTCCCACATTTGACCAAGGAGTGCCTGGTAGCGTTGAGATGTGGGAGAGAATGC
ACT
AATCTGAAGGCAGCCCTGCGTCAGGAATTCAGCAACCTGGAAGAGATTCTTGAGTATCAGAACACCA
CC
TTCTTTGGTGGAACCTGTATATCCATGATTGATTACCTCCTCTGGCCCTGGTTTGAGCGGCTGGATGT
G
TATGGGATACTGGACTGTGTGAGCCACACGCCAGCCCTGCGGCTCTGGATATCAGCCATGAAGTGGGAC
CCC
ACAGTCTGTGCTCTTCTCATGGATAAGAGCATTTTCCAGGGCTTCTTGAATCTCTATTTTCAGAACA
AC
CCTAATGCCTTTGACTTTGGGCTGTGCTGA


Translation (243 aa):
MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFG
H
IPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCK
VPHLTKECLVALRCGREC
T
NLKAALRQEFSNLEE
ILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWD
P
TVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser