NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS75525.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
75525.1 Public Homo sapiens 6 BCLAF1 22 109 92 CCDS HistoryNCBI Gene:9774Re-query CCDS DB by CCDS ID:75525.1Re-query CCDS DB by GeneID:9774See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 75525.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000527759.5 ENSP00000434826.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000527759.5Link to Ensembl Protein Viewer:ENSP00000434826.1Re-query CCDS DB by Nucleotide ID:ENST00000527759Re-query CCDS DB by Protein ID:ENSP00000434826
Original member NCBI NM_001301038.1 NP_001287967.1 Updated not alive Link to Nucleotide Sequence:NM_001301038.1Link to Protein Sequence:NP_001287967.1Re-query CCDS DB by Nucleotide ID:NM_001301038Re-query CCDS DB by Protein ID:NP_001287967
NCBI NM_001301038.2 NP_001287967.1 Updated not alive Link to Nucleotide Sequence:NM_001301038.2Link to Protein Sequence:NP_001287967.1Re-query CCDS DB by Nucleotide ID:NM_001301038Re-query CCDS DB by Protein ID:NP_001287967
Current member NCBI NM_001301038.3 NP_001287967.1 Accepted alive Link to Nucleotide Sequence:NM_001301038.3Link to Protein Sequence:NP_001287967.1Re-query CCDS DB by Nucleotide ID:NM_001301038Re-query CCDS DB by Protein ID:NP_001287967Link to BLAST:NP_001287967.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001287967.1 918 Q9NYF8-2 918 100% 0 0

Chromosomal Locations for CCDS 75525.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 136261110 136261115 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136261265 136261477 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136267029 136267175 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136268162 136268339 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136269437 136269612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136271995 136272079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136273082 136273187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136275532 136275701 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136275843 136276508 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136277865 136278770 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6
6 136279763 136279866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2757 nt):
ATGGGTCGCTCCAATTCTAGATCACATTCTTCAAGGTCAAAGTCTAGATCACAGTCTAGTTCTCGATCAA
GA
TCAAGATCTCATTCTAGAAAGAAGCGATACAGGTCTCGTTCCAGAACATATTCAAGGTCTCGTAGTAG
A
GATCGTATGTATTCTAGAGATTATCGTCGCGATTACAGAAATAATAGAGGAATGAGACGACCTTATGGG
TAC
AGAGGAAGGGGTAGAGGGTATTATCAAGGAGGAGGAGGTAGATATCATCGAGGTGGTTATAGACCTG
TC
TGGAATAGAAGGCACTCTAGGAGTCCTAGACGAGGTCGTTCACGTTCCAGGAGTCCAAAAAGAAGATC
C
GTTTCTTCTCAAAGATCCAGAAGCAGATCTCGCCGGTCATATAGATCTTCTAGGTCTCCAAGATCATCC
TCT
TCTCGTTCTTCATCCCCATATAGCAAATCTCCTGTTTCTAAAAGACGAGGGTCTCAGGAAAAACAAA
CC
AAAAAAGCTGAAGGGGAACCCCAAGAAGAGAGTCCGTTGAAAAGTAAATCACAGGAGGAACCGAAAGA
T
ACATTTGAACATGACCCATCTGAGTCTATCGATGAATTTAATAAGTCATCAGCCACATCCGGTGATATT
TGG
CCTGGCCTTTCAGCTTATGATAATAGTCCTAGATCACCCCATAGTCCTTCACCTATTGCTACACCAC
CT
AGTCAGAGTTCATCTTGCTCTGATGCTCCCATGCTCAGTACAGTTCACTCTGCAAAAAATACTCCTTC
T
CAGCATTCACATTCCATTCAGCATAGTCCTGAAAGGTCTGGGTCTGGTTCTGTTGGAAATGGATCTAGT
CGA
TACAGTCCTTCTCAGAATAGTCCAATTCATCACATCCCTTCACGAAGAAGTCCTGCAAAGACAATCG
CA
CCACAGAATGCTCCAAGAGATGAGTCTAGGGGCCGTTCCTCGTTTTATCCTGATGGTGGAGATCAGGA
A
ACTGCAAAGACTGGGAAGTTCTTAAAAAGGTTCACAGATGAAGAGTCTAGAGTATTCCTGCTTGATAGG
GGT
AATACCAGGGATAAAGAGGCTTCAAAAGAGAAAGGATCAGAGAAAGGGAGGGCAGAGGGAGAATGGG
AA
GATCAGGAAGCTCTAGATTACTTCAGTGATAAAGAGTCTGGAAAACAAAAGTTTAATGATTCAGAAGG
G
GATGACACAGAGGAGACAGAGGATTATAGACAGTTCAGGAAGTCAGTCCTCGCAGATCAGGGTAAAAGT
TTT
GCTACTGCATCTCACCGGAATACTGAGGAGGAAGGACTCAAGTACAAGTCCAAAGTTTCACTGAAAG
GC
AATAGAGAAAGTGATGGATTTAGAGAAGAAAAAAATTATAAACTTAAAGAGACTGGATATGTAGTGGA
A
AGGCCTAGCACTACAAAAGATAAGCACAAAGAAGAAGACAAAAATTCTGAAAGAATAACAGTAAAGAAA
GAA
ACTCAGTCACCTGAGCAGGTAAAGTCTGAAAAGCTCAAAGACCTCTTTGATTACAGTCCCCCTCTAC
AC
AAGAATCTGGATGCACGAGAAAAGTCTACCTTCAGAGAGGAAAGCCCACTTAGGATCAAAATGATAGC
G
AGTGATTCTCACCGTCCTGAAGTCAAACTCAAAATGGCACCTGTTCCTCTTGATGATTCTAACAGACCT
GCT
TCCTTGACTAAAGACAGGCTGCTTGCTAGTACACTTGTCCATTCTGTCAAGAAGGAGCAAGAATTCC
GA
TCCATCTTTGACCACATTAAGTTGCCACAGGCCAGCAAAAGCACTTCAGAGTCATTTATTCAACACAT
T
GTGTCCTTGGTTCATCATGTTAAAGAGCAATACTTCAAGTCAGCTGCAATGACCCTAAACGAGCGGTTC
ACT
TCGTATCAGAAAGCCACTGAAGAACATAGTACTCGGCAAAAGAGCCCTGAAATACACAGGAGAATTG
AC
ATCTCACCAAGTACCCTGAGGAAGCATACCCGTTTAGCAGGGGAAGAGAGAGTTTTTAAAGAAGAAAA
T
CAAAAGGGAGATAAAAAATTAAGGTGTGACTCTGCTGACCTTCGGCATGACATTGATCGCCGTAGAAAA
GAA
AGAAGTAAAGAACGGGGAGATTCCAAGGGCTCCAGGGAATCCAGTGGATCAAGAAAGCAGGAAAAAA
CT
CCAAAAGATTACAAGGAATACAAATCTTACAAAGATGACAGTAAACATAAAAGAGAGCAAGATCATTC
T
CGATCTTCATCCTCTTCAGCATCACCTTCTTCTCCCAGTTCTCGAGAAGAAAAGGAGAGTAAGAAGGAA
AGA
GAAGAAGAATTTAAAACTCACCATGAAATGAAAGAATACTCAGGCTTTGCAGGAGTTAGCCGACCAC
GA
GGAACCTTTTTTCGAATTAGAGGCAGAGGAAGAGCCAGAGGAGTTTTTGCTGGGACAAATACTGGTCC
A
AACAACTCAAATACTACTTTTCAAAAGAGACCGAAGGAAGAGGAATGGGATCCAGAATATACCCCAAAG
AGC
AAGAAGTACTTCTTGCATGACGACAGAGATGATGGTGTGGATTATTGGGCCAAAAGAGGAAGAGGTC
GT
GGTACTTTTCAACGTGGCAGAGGGCGCTTTAACTTCAAAAAATCAGGTAGCAGTCCTAAATGGACTCA
T
GACAAATACCAAGGGGATGGGATTGTTGAAGATGAAGAAGAGACCATGGAAAATAATGAAGAAAAGAAG
GAC
AGACGCAAGGAAGAAAAGGAATAA


Translation (918 aa):
MGRSNSRSHSSRSKSRSQSSSRSRSRSHSRKKRYRSRSRTYSRSRSRDRMYSRDYRRDYRNNRGMRRPYG
Y
RGRGRGYYQGGGGRYHRGGYRPVWNRRHSRSPRRGRSRSRSPKRRSVSSQRSRSRSRRSYRSSRSPRSS
S
SRSSSPYSKSPVSKRRGSQEKQTKKAEGEPQEESPLKSKSQEEPKDTFEHDPSESIDEFNKSSATSGDI
W
PGLSAYDNSPRSPHSPSPIATPPSQSSSCSDAPMLSTVHSAKNTPSQHSHSIQHSPERSGSGSVGNGSS
R
YSPSQNSPIHHIPSRRSPAKTIAPQNAPRDESRGRSSFYPDGGDQETAKTGKFLK
RFTDEESRVFLLDR
G
NTRDKEASKEKGSEKGRAEGEWEDQEALDYFSDKESGKQKFNDSEGDDTEETEDYRQFRKSVLADQGKS
F
ATASHRNTEEEGLKYKSKVSLKGNRESDGFREEKNYKLKETGYVVERPSTTKDKHKEEDKNSERITVKK
E
TQSPEQVKSEKLKDLFDYSPPLHKNLDAREKSTFREESPLRIKMIASDSHRPEVKLKMAPVPLDDSN
RP
A
SLTKDRLLASTLVHSVKKEQEFRSIFDHIKLPQASKSTSESFIQHIVSLVHHVK
EQYFKSAAMTLNERF
T
SYQKATEEHSTRQKSPEIH
RRIDISPSTLRKHTRLAGEERVFKEENQKGDKKLRCDSADLRHDIDRRRK
E
RSKERGDSKGSRESSGSRKQEKTPKDYKEYKSYKDD
SKHKREQDHSRSSSSSASPSSPSSREEKESKKE
R
EEEFKTHHEMKEYSGFAGVSRPRGTF
FRIRGRGRARGVFAGTNTGPNNSNTTFQKRPKEEEWDPEYTPK
S
KKYFL
HDDRDDGVDYWAKRGRGRGTFQRGRGRFNFKKSGSSPKWTHDKYQGDGIVEDEEETMENNEEKK
D
RRKEEK
E



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser