NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS75154.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
75154.1 Public Homo sapiens 4 ENOPH1 22 109 92 CCDS HistoryNCBI Gene:58478Re-query CCDS DB by CCDS ID:75154.1Re-query CCDS DB by GeneID:58478See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 75154.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000509635.5 ENSP00000422005.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000509635.5Link to Ensembl Protein Viewer:ENSP00000422005.1Re-query CCDS DB by Nucleotide ID:ENST00000509635Re-query CCDS DB by Protein ID:ENSP00000422005
Original member NCBI NM_001292017.1 NP_001278946.1 Updated not alive Link to Nucleotide Sequence:NM_001292017.1Link to Protein Sequence:NP_001278946.1Re-query CCDS DB by Nucleotide ID:NM_001292017Re-query CCDS DB by Protein ID:NP_001278946
Current member NCBI NM_001292017.2 NP_001278946.1 Accepted alive Link to Nucleotide Sequence:NM_001292017.2Link to Protein Sequence:NP_001278946.1Re-query CCDS DB by Nucleotide ID:NM_001292017Re-query CCDS DB by Protein ID:NP_001278946Link to BLAST:NP_001278946.1

Chromosomal Locations for CCDS 75154.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 82451121 82451245 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 82454722 82454854 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 82456915 82457038 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 82459981 82460120 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (522 nt):
ATGATCCAGGCCGTGGTAGATAATGTGTGCTGGCAGATGTCCCTGGATCGAAAGACCACTGCACTCAAAC
AG
CTGCAGGGCCACATGTGGAGGGCGGCATTCACAGCTGGGCGCATGAAAGCAGAGTTCTTTGCAGATGT
A
GTTCCAGCAGTCAGGAAGTGGAGAGAGGCCGGAATGAAGGTGTACATCTATTCCTCAGGGAGTGTGGAG
GCA
CAGAAACTGTTATTCGGGCATTCTACGGAGGGAGATATTCTTGAGCTTGTTGATGGTCACTTTGATA
CC
AAGATTGGACACAAAGTAGAGAGTGAAAGTTACCGAAAGATTGCAGACAGCATTGGGTGCTCAACCAA
C
AACATTTTGTTTCTGACAGATGTTACTCGAGAGGCCAGTGCTGCTGAGGAAGCAGATGTGCACGTAGCT
GTG
GTGGTGAGACCAGGCAACGCAGGATTAACAGATGATGAGAAGACTTACTACAGCCTCATCACATCCT
TC
AGTGAACTATACCTGCCTTCCTCAACCTAG


Translation (173 aa):
MIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVE
A
QKLLFGHSTEGDILE
LVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVA
V
VVRPGNAGLTDDEKTYYSLITSFSELYLPSST




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser