NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS75137.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
75137.1 Public Homo sapiens 4 UGT2B4 24 110 108 CCDS HistoryNCBI Gene:7363Re-query CCDS DB by CCDS ID:75137.1Re-query CCDS DB by GeneID:7363See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 75137.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000512583.5 ENSP00000421290.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000512583.5Link to Ensembl Protein Viewer:ENSP00000421290.1Re-query CCDS DB by Nucleotide ID:ENST00000512583Re-query CCDS DB by Protein ID:ENSP00000421290
Original member Current member NCBI NM_001297615.2 NP_001284544.1 Accepted alive Link to Nucleotide Sequence:NM_001297615.2Link to Protein Sequence:NP_001284544.1Re-query CCDS DB by Nucleotide ID:NM_001297615Re-query CCDS DB by Protein ID:NP_001284544Link to BLAST:NP_001284544.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001284544.1 369 P06133-3 369 100% 0 0

Chromosomal Locations for CCDS 75137.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 69480891 69480910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 69486609 69486696 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 69489439 69489570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 69493693 69493841 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4
4 69495141 69495861 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1110 nt):
ATGTCTATGAAATGGACTTCAGCTCTTCTGCTGATACAGCTGAGCTGTTACTTTAGCTCTGGGAGTTGTG
GA
AAGGTGCTGGTGTGGCCCACAGAATTCAGCCACTGGATGAATATAAAGACAATCCTGGATGAACTTGT
C
CAGAGAGGTCATGAGGTGACTGTATTGGCATCTTCAGCTTCCATTTCTTTCGATCCCAACAGCCCATCT
ACT
CTTAAATTTGAAGTTTATCCTGTATCTTTAACTAAAACTGAGTTTGAGGATATTATCAAGCAGCTGG
TT
AAGAGATGGGCAGAACTTCCAAAAGACACATTTTGGTCATATTTTTCACAAGTACAAGAAATCATGTG
G
ACATTTAATGACATACTTAGAAAGTTCTGTAAGGATATAGTTTCAAATAAGAAACTTATGAAGAAACTA
CAG
GAGTCAAGATTTGATGTTGTTCTTGCAGATGCTGTTTTCCCCTTTGGTGAGCTGCTGGCCGAGTTAC
TT
AAAATACCCTTTGTCTACAGCCTCCGCTTCTCTCCTGGCTACGCAATTGAAAAGCATAGTGGAGGACT
T
CTGTTCCCTCCTTCCTATGTGCCTGTTGTTATGTCAGAACTAAGTGACCAAATGACTTTCATAGAGAGG
GTA
AAAAATATGATCTATGTGCTTTATTTTGAATTTTGGTTCCAAATATTTGACATGAAGAAGTGGGATC
AG
TTCTACAGTGAAGTTCTAGGAAGACCCACTACGTTATCTGAGACAATGGCAAAAGCTGACATATGGCT
T
ATTCGAAACTACTGGGATTTTCAATTTCCTCACCCACTCTTACCAAATGTTGAGTTCGTTGGAGGACTC
CAC
TGCAAACCTGCCAAACCCCTACCGAAGGAAATGGAAGAGTTTGTCCAGAGCTCTGGAGAAAATGGTG
TT
GTGGTGTTTTCTCTGGGGTCGATGGTCAGTAACACGTCAGAAGAAAGGGCCAATGTAATTGCATCAGC
C
CTTGCCAAGATCCCACAAAAGGTTCTGTGGAGATTTGATGGGAATAAACCAGATACTTTAGGACTCAAT
ACT
CGGCTGTACAAGTGGATACCCCAGAATGATCTTCTTGATATAAAGAGAATGCTATGA


Translation (369 aa):
MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPS
T
LKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILRKFCKDIVSNKKLMKKL
Q
ESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIER
V
KNMIYVLYFEFWFQIFDMKKWDQFYSEVL
GRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGL
H
CKPAKPLPK
EMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLN
T
RLYKWIPQNDLL
DIKRML



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser