NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS7511.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7511.1 Public Homo sapiens 10 BTRC 22 109 92 CCDS HistoryNCBI Gene:8945Re-query CCDS DB by CCDS ID:7511.1Re-query CCDS DB by GeneID:8945See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7511.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000408038.6 ENSP00000385339.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000408038.6Link to Ensembl Protein Viewer:ENSP00000385339.2Re-query CCDS DB by Nucleotide ID:ENST00000408038Re-query CCDS DB by Protein ID:ENSP00000385339
Original member Current member NCBI NM_003939.4 NP_003930.1 Accepted alive Link to Nucleotide Sequence:NM_003939.4Link to Protein Sequence:NP_003930.1Re-query CCDS DB by Nucleotide ID:NM_003939Re-query CCDS DB by Protein ID:NP_003930Link to BLAST:NP_003930.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003930.1 569 Q9Y297-2 569 100% 0 0

Chromosomal Locations for CCDS 7511.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 101354181 101354228 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101461981 101462058 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101479368 101479457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101521639 101521870 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101526013 101526199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101531237 101531333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101532295 101532432 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101532952 101533070 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101534661 101534910 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101535354 101535472 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101536543 101536653 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101538293 101538371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 101550699 101550860 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1710 nt):
ATGGACCCGGCCGAGGCGGTGCTGCAAGAGAAGGCACTCAAGTTTATGAATTCCTCAGAGAGAGAAGACT
GT
AATAATGGCGAACCCCCTAGGAAGATAATACCAGAGAAGAATTCACTTAGACAGACATACAACAGCTG
T
GCCAGACTCTGCTTAAACCAAGAAACAGTATGTTTAGCAAGCACTGCTATGAAGACTGAGAATTGTGTG
GCC
AAAACAAAACTTGCCAATGGCACTTCCAGTATGATTGTGCCCAAGCAACGGAAACTCTCAGCAAGCT
AT
GAAAAGGAAAAGGAACTGTGTGTCAAATACTTTGAGCAGTGGTCAGAGTCAGATCAAGTGGAATTTGT
G
GAACATCTTATATCCCAAATGTGTCATTACCAACATGGGCACATAAACTCGTATCTTAAACCTATGTTG
CAG
AGAGATTTCATAACTGCTCTGCCAGCTCGGGGATTGGATCATATTGCTGAGAACATTCTGTCATACC
TG
GATGCCAAATCACTATGTGCTGCTGAACTTGTGTGCAAGGAATGGTACCGAGTGACCTCTGATGGCAT
G
CTGTGGAAGAAGCTTATCGAGAGAATGGTCAGGACAGATTCTCTGTGGAGAGGCCTGGCAGAACGAAGA
GGA
TGGGGACAGTATTTATTCAAAAACAAACCTCCTGACGGGAATGCTCCTCCCAACTCTTTTTATAGAG
CA
CTTTATCCTAAAATTATACAAGACATTGAGACAATAGAATCTAATTGGAGATGTGGAAGACATAGTTT
A
CAGAGAATTCACTGCCGAAGTGAAACAAGCAAAGGAGTTTACTGTTTACAGTATGATGATCAGAAAATA
GTA
AGCGGCCTTCGAGACAACACAATCAAGATCTGGGATAAAAACACATTGGAATGCAAGCGAATTCTCA
CA
GGCCATACAGGTTCAGTCCTCTGTCTCCAGTATGATGAGAGAGTGATCATAACAGGATCATCGGATTC
C
ACGGTCAGAGTGTGGGATGTAAATACAGGTGAAATGCTAAACACGTTGATTCACCATTGTGAAGCAGTT
CTG
CACTTGCGTTTCAATAATGGCATGATGGTGACCTGCTCCAAAGATCGTTCCATTGCTGTATGGGATA
TG
GCCTCCCCAACTGACATTACCCTCCGGAGGGTGCTGGTCGGACACCGAGCTGCTGTCAATGTTGTAGA
C
TTTGATGACAAGTACATTGTTTCTGCATCTGGGGATAGAACTATAAAGGTATGGAACACAAGTACTTGT
GAA
TTTGTAAGGACCTTAAATGGACACAAACGAGGCATTGCCTGTTTGCAGTACAGGGACAGGCTGGTAG
TG
AGTGGCTCATCTGACAACACTATCAGATTATGGGACATAGAATGTGGTGCATGTTTACGAGTGTTAGA
A
GGCCATGAGGAATTGGTGCGTTGTATTCGATTTGATAACAAGAGGATAGTCAGTGGGGCCTATGATGGA
AAA
ATTAAAGTGTGGGATCTTGTGGCTGCTTTGGACCCCCGTGCTCCTGCAGGGACACTCTGTCTACGGA
CC
CTTGTGGAGCATTCCGGAAGAGTTTTTCGACTACAGTTTGATGAATTCCAGATTGTCAGTAGTTCACA
T
GATGACACAATCCTCATCTGGGACTTCCTAAATGATCCAGCTGCCCAAGCTGAACCCCCCCGTTCCCCT
TCT
CGAACATACACCTACATCTCCAGATAA


Translation (569 aa):
MDPAEAVLQEKALKFMNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCV
A
K
TKLANGTSSMIVPKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPML
Q
RDFITALP
ARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERR
G
WGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKI
V
SGLRDNTIK
IWDKNTLECKRILTGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAV
L
HLRFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIK
VWNTSTC
E
FVRTLNGHKRGIACLQYRDRLVVSGSSDNTI
RLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDG
K
IKVWDLVAALDPRAPAGTLCLRTLV
EHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSP
S
RTYTYISR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser