NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS74847.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
74847.1 Public Homo sapiens 22 INPP5J 22 109 92 CCDS HistoryNCBI Gene:27124Re-query CCDS DB by CCDS ID:74847.1Re-query CCDS DB by GeneID:27124See the combined annotation on chromosome 22 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 74847.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000620191.4 ENSP00000479645.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000620191.4Link to Ensembl Protein Viewer:ENSP00000479645.1Re-query CCDS DB by Nucleotide ID:ENST00000620191Re-query CCDS DB by Protein ID:ENSP00000479645
Original member Current member NCBI NM_001284287.1 NP_001271216.1 Accepted alive Link to Nucleotide Sequence:NM_001284287.1Link to Protein Sequence:NP_001271216.1Re-query CCDS DB by Nucleotide ID:NM_001284287Re-query CCDS DB by Protein ID:NP_001271216Link to BLAST:NP_001271216.1

Chromosomal Locations for CCDS 74847.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 31126410 31126489 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31126613 31126721 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31126921 31127037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31127357 31127532 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31127951 31128062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31128214 31128323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31128471 31128654 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31133098 31133235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31133406 31133483 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31133610 31133714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 31133913 31134419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1716 nt):
ATGCCCCCAGACGATGTCACATCCCTCCTCCACCTGGGCGGTGGTGACGACAGCGACGGCGCAGACATGA
TC
GCCATAGGGTTGCAGGAAGTGAACTCCATGCTCAACAAGCGACTCAAGGACGCCCTCTTCACGGACCA
G
TGGAGTGAGCTGTTCATGGATGCGCTAGGGCCCTTCAACTTCGTGCTGGTGAGTTCGGTGAGGATGCAG
GGT
GTCATCCTGCTGCTGTTCGCCAAGTACTACCACCTGCCCTTCCTGCGAGACGTGCAGACCGACTGCA
CG
CGCACTGGCCTGGGCGGCTACTGGGGTAACAAGGGTGGCGTGAGCGTGCGCCTGGCGGCCTTCGGGCA
C
ATGCTCTGCTTCCTGAACTGCCACTTGCCTGCGCATATGGACAAGGCGGAGCAGCGCAAAGACAACTTC
CAG
ACCATCCTCAGCCTCCAGCAGTTCCAAGGGCCGGGCGCACAGGGCATCCTGGATCATGACCTCGTGT
TC
TGGTTCGGGGACCTGAACTTCCGCATTGAGAGCTATGACCTGCACTTTGTCAAGTTTGCCATCGACAG
T
GACCAGCTCCATCAGCTCTGGGAGAAGGACCAGCTCAACATGGCCAAGAACACCTGGCCCATTCTGAAG
GGC
TTTCAGGAGGGGCCCCTCAACTTCGCTCCCACCTTCAAGTTTGATGTGGGTACCAACAAATACGATA
CC
AGTGCCAAGAAACGGAAGCCAGCTTGGACAGACCGTATCCTATGGAAGGTCAAGGCTCCAGGTGGGGG
T
CCCAGCCCCTCAGGACGGAAGAGCCACCGACTCCAGGTGACGCAGCACAGCTACCGCAGCCACATGGAA
TAC
ACAGTCAGCGACCACAAGCCTGTGGCTGCCCAGTTCCTCCTGCAGTTTGCCTTCAGGGACGACATGC
CA
CTGGTGCGGCTGGAGGTGGCAGATGAGTGGGTGCGGCCCGAGCAGGCGGTGGTGAGGTACCGCATGGA
A
ACAGTGTTCGCCCGCAGCTCCTGGGACTGGATCGGCTTATACCGGGTGGGTTTCCGCCATTGCAAGGAC
TAT
GTGGCTTATGTCTGGGCCAAACATGAAGATGTGGATGGGAATACCTACCAGGTAACATTCAGTGAGG
AA
TCACTGCCCAAGGGCCATGGAGACTTCATCCTGGGCTACTATAGTCACAACCACAGCATCCTCATCGG
C
ATCACTGAACCCTTCCAGATCTCGCTGCCTTCCTCGGAGTTGGCCAGCAGCAGCACAGACAGCTCAGGC
ACC
AGCTCAGAGGGAGAGGATGACAGCACACTGGAGCTCCTTGCACCCAAGTCCCGCAGCCCCAGTCCTG
GC
AAGTCCAAGCGACACCGCAGCCGCAGCCCGGGACTGGCCAGGTTCCCTGGGCTTGCCCTACGGCCCTC
A
TCCCGTGAACGCCGTGGTGCCAGCCGTAGCCCCTCACCCCAGAGCCGCCGCCTGTCCCGAGTGGCTCCT
GAC
AGGAGCAGTAATGGCAGCAGCCGGGGCAGTAGTGAAGAGGGGCCCTCTGGGTTGCCTGGCCCCTGGG
CC
TTCCCACCAGCTGTGCCTCGAAGCCTGGGCCTGTTGCCCGCCTTGCGCCTAGAGACTGTAGACCCTGG
T
GGTGGTGGCTCCTGGGGACCTGATCGGGAGGCCCTGGCGCCCAACAGCCTGTCTCCTAGTCCCCAGGGC
CAT
CGGGGGCTGGAGGAAGGGGGCCTGGGGCCCTGA


Translation (571 aa):
MPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQ
G
VILLLFAKYYHLPFLRDVQTDCTRTGLGGYW
GNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNF
Q
TILSLQQFQGPGAQGILDH
DLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILK
G
FQEGPLNFAPTFKFDVGTNKYDT
SAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHME
Y
TVSDHKPVAAQFLLQ
FAFRDDMPLVRLEVADEWVRPEQAVVRYRMETVFARSSWDWIGLYRVGFRHCKD
Y
VAYVWAKHEDVDGNTYQ
VTFSEESLPKGHGDFILGYYSHNHSILIGITEPFQISLPSSELASSSTDSSG
T
SSEGEDDSTLELLAPKSRSPSPGKSKRHRSRSPGLARFPGLALRPSSRERRGASRSPSPQSRRLSRVAP
D
RSSNGSSRGSSEEGPSGLPGPWAFPPAVPRSLGLLPALRLETVDPGGGGSWGPDREALAPNSLSPSPQG
H
RGLEEGGLGP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser