NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS74672.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
74672.1 Public Homo sapiens 2 INPP5D 22 109 92 CCDS HistoryNCBI Gene:3635Re-query CCDS DB by CCDS ID:74672.1Re-query CCDS DB by GeneID:3635See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 74672.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000445964.5 ENSP00000405338.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000445964.5Link to Ensembl Protein Viewer:ENSP00000405338.2Re-query CCDS DB by Nucleotide ID:ENST00000445964Re-query CCDS DB by Protein ID:ENSP00000405338
Original member NCBI NM_001017915.2 NP_001017915.1 Updated not alive Link to Nucleotide Sequence:NM_001017915.2Link to Protein Sequence:NP_001017915.1Re-query CCDS DB by Nucleotide ID:NM_001017915Re-query CCDS DB by Protein ID:NP_001017915
Current member NCBI NM_001017915.3 NP_001017915.1 Accepted alive Link to Nucleotide Sequence:NM_001017915.3Link to Protein Sequence:NP_001017915.1Re-query CCDS DB by Nucleotide ID:NM_001017915Re-query CCDS DB by Protein ID:NP_001017915Link to BLAST:NP_001017915.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001017915.1 1189 Q92835-1 1189 100% 0 0

Chromosomal Locations for CCDS 74672.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 2 (NC_000002.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 233060479 233060612 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233079335 233079398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233122107 233122257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233125745 233125919 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233130508 233130648 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233139842 233139929 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233146162 233146242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233146367 233146438 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233147471 233147594 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233158313 233158419 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233161724 233161826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233163707 233163903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233164307 233164424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233169305 233169401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233170026 233170164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233170496 233170604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233171064 233171152 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233177265 233177346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233182410 233182499 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233184408 233184521 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233185843 233185925 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233189850 233189937 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233193812 233193961 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233195399 233195495 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233198095 233198376 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233204126 233204717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2
2 233206706 233206708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3570 nt):
ATGGTCCCCTGCTGGAACCATGGCAACATCACCCGCTCCAAGGCGGAGGAGCTGCTTTCCAGGACAGGCA
AG
GACGGGAGCTTCCTCGTGCGTGCCAGCGAGTCCATCTCCCGGGCATACGCGCTCTGCGTGCTGTATCG
G
AATTGCGTTTACACTTACAGAATTCTGCCCAATGAAGATGATAAATTCACTGTTCAGGCATCCGAAGGC
GTC
TCCATGAGGTTCTTCACCAAGCTGGACCAGCTCATCGAGTTTTACAAGAAGGAAAACATGGGGCTGG
TG
ACCCATCTGCAATACCCTGTGCCGCTGGAGGAAGAGGACACAGGCGACGACCCTGAGGAGGACACAGT
A
GAAAGTGTCGTGTCTCCACCCGAGCTGCCCCCAAGAAACATCCCGCTGACTGCCAGCTCCTGTGAGGCC
AAG
GAGGTTCCTTTTTCAAACGAGAATCCCCGAGCGACCGAGACCAGCCGGCCGAGCCTCTCCGAGACAT
TG
TTCCAGCGACTGCAAAGCATGGACACCAGTGGGCTTCCAGAAGAGCATCTTAAGGCCATCCAAGATTA
T
TTAAGCACTCAGCTCGCCCAGGACTCTGAATTTGTGAAGACAGGGTCCAGCAGTCTTCCTCACCTGAAG
AAA
CTGACCACACTGCTCTGCAAGGAGCTCTATGGAGAAGTCATCCGGACCCTCCCATCCCTGGAGTCTC
TG
CAGAGGTTATTTGACCAGCAGCTCTCCCCGGGCCTCCGTCCACGTCCTCAGGTTCCTGGTGAGGCCAA
T
CCCATCAACATGGTGTCCAAGCTCAGCCAACTGACAAGCCTGTTGTCGTCCATTGAAGACAAGGTCAAG
GCC
TTGCTGCACGAGGGTCCTGAGTCTCCGCACCGGCCCTCCCTTATCCCTCCAGTCACCTTTGAGGTGA
AG
GCAGAGTCTCTGGGGATTCCTCAGAAAATGCAGCTCAAAGTCGACGTTGAGTCTGGGAAACTGATCAT
T
AAGAAGTCCAAGGATGGTTCTGAGGACAAGTTCTACAGCCACAAGAAAATCCTGCAGCTCATTAAGTCA
CAG
AAATTTCTGAATAAGTTGGTGATCTTGGTGGAAACAGAGAAGGAGAAGATCCTGCGGAAGGAATATG
TT
TTTGCTGACTCCAAAAAGAGAGAAGGCTTCTGCCAGCTCCTGCAGCAGATGAAGAACAAGCACTCAGA
G
CAGCCGGAGCCCGACATGATCACCATCTTCATCGGCACCTGGAACATGGGTAACGCCCCCCCTCCCAAG
AAG
ATCACGTCCTGGTTTCTCTCCAAGGGGCAGGGAAAGACGCGGGACGACTCTGCGGACTACATCCCCC
AT
GACATTTACGTGATCGGCACCCAAGAGGACCCCCTGAGTGAGAAGGAGTGGCTGGAGATCCTCAAACA
C
TCCCTGCAAGAAATCACCAGTGTGACTTTTAAAACAGTCGCCATCCACACGCTCTGGAACATCCGCATC
GTG
GTGCTGGCCAAGCCTGAGCACGAGAACCGGATCAGCCACATCTGTACTGACAACGTGAAGACAGGCA
TT
GCAAACACACTGGGGAACAAGGGAGCCGTGGGGGTGTCGTTCATGTTCAATGGAACCTCCTTAGGGTT
C
GTCAACAGCCACTTGACTTCAGGAAGTGAAAAGAAACTCAGGCGAAACCAAAACTATATGAACATTCTC
CGG
TTCCTGGCCCTGGGCGACAAGAAGCTGAGTCCCTTTAACATCACTCACCGCTTCACGCACCTCTTCT
GG
TTTGGGGATCTTAACTACCGTGTGGATCTGCCTACCTGGGAGGCAGAAACCATCATCCAGAAAATCAA
G
CAGCAGCAGTACGCAGACCTCCTGTCCCACGACCAGCTGCTCACAGAGAGGAGGGAGCAGAAGGTCTTC
CTA
CACTTCGAGGAGGAAGAAATCACGTTTGCCCCAACCTACCGTTTTGAGAGACTGACTCGGGACAAAT
AC
GCCTACACCAAGCAGAAAGCGACAGGGATGAAGTACAACTTGCCTTCCTGGTGTGACCGAGTCCTCTG
G
AAGTCTTATCCCCTGGTGCACGTGGTGTGTCAGTCTTATGGCAGTACCAGCGACATCATGACGAGTGAC
CAC
AGCCCTGTCTTTGCCACATTTGAGGCAGGAGTCACTTCCCAGTTTGTCTCCAAGAACGGTCCCGGGA
CT
GTTGACAGCCAAGGACAGATTGAGTTTCTCAGGTGCTATGCCACATTGAAGACCAAGTCCCAGACCAA
A
TTCTACCTGGAGTTCCACTCGAGCTGCTTGGAGAGTTTTGTCAAGAGTCAGGAAGGAGAAAATGAAGAA
GGA
AGTGAGGGGGAGCTGGTGGTGAAGTTTGGTGAGACTCTTCCAAAGCTGAAGCCCATTATCTCTGACC
CT
GAGTACCTGCTAGACCAGCACATCCTCATCAGCATCAAGTCCTCTGACAGCGACGAATCCTATGGCGA
G
GGCTGCATTGCCCTTCGGTTAGAGGCCACAGAAACGCAGCTGCCCATCTACACGCCTCTCACCCACCAT
GGG
GAGTTGACAGGCCACTTCCAGGGGGAGATCAAGCTGCAGACCTCTCAGGGCAAGACGAGGGAGAAGC
TC
TATGACTTTGTGAAGACGGAGCGTGATGAATCCAGTGGGCCAAAGACCCTGAAGAGCCTCACCAGCCA
C
GACCCCATGAAGCAGTGGGAAGTCACTAGCAGGGCCCCTCCGTGCAGTGGCTCCAGCATCACTGAAATC
ATC
AACCCCAACTACATGGGAGTGGGGCCCTTTGGGCCACCAATGCCCCTGCACGTGAAGCAGACCTTGT
CC
CCTGACCAGCAGCCCACAGCCTGGAGCTACGACCAGCCGCCCAAGGACTCCCCGCTGGGGCCCTGCAG
G
GGAGAAAGTCCTCCGACACCTCCCGGCCAGCCGCCCATATCACCCAAGAAGTTTTTACCCTCAACAGCA
AAC
CGGGGTCTCCCTCCCAGGACACAGGAGTCAAGGCCCAGTGACCTGGGGAAGAACGCAGGGGACACGC
TG
CCTCAGGAGGACCTGCCGCTGACGAAGCCCGAGATGTTTGAGAACCCCCTGTATGGGTCCCTGAGTTC
C
TTCCCTAAGCCTGCTCCCAGGAAGGACCAGGAATCCCCCAAAATGCCGCGGAAGGAACCCCCGCCCTGC
CCG
GAACCCGGCATCTTGTCGCCCAGCATCGTGCTCACCAAAGCCCAGGAGGCTGATCGCGGCGAGGGGC
CC
GGCAAGCAGGTGCCCGCGCCCCGGCTGCGCTCCTTCACGTGCTCATCCTCTGCCGAGGGCAGGGCGGC
C
GGCGGGGACAAGAGCCAAGGGAAGCCCAAGACCCCGGTCAGCTCCCAGGCCCCGGTGCCGGCCAAGAGG
CCC
ATCAAGCCTTCCAGATCGGAAATCAACCAGCAGACCCCGCCCACCCCGACGCCGCGGCCGCCGCTGC
CA
GTCAAGAGCCCGGCGGTGCTGCACCTCCAGCACTCCAAGGGCCGCGACTACCGCGACAACACCGAGCT
C
CCGCATCACGGCAAGCACCGGCCGGAGGAGGGGCCACCAGGGCCTCTAGGCAGGACTGCCATGCAGTGA


Translation (1189 aa):
MVPCWNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQASEG
V
SMRFFTKLDQLIEFYKKENMGLVTHLQYPVPLEEEDTGDDPEEDT
VESVVSPPELPPRNIPLTASSCEA
K
EVPFSNENPRATETSRPSLSETLFQRLQSMDTS
GLPEEHLKAIQDYLSTQLAQDSEFVKTGSSSLPHLK
K
LTTLLCKELY
GEVIRTLPSLESLQRLFDQQLSPGLRPRPQVPGEANPINMVSKLSQLTSLLSSIEDKVK
A
LLHEGPESPHRPSLIPPVTFE
VKAESLGIPQKMQLKVDVESGKLIIKKSKDGSEDKFYSHKKILQLIKS
Q
KFLNKLVILVETEKEKILRKEYVFADSK
KREGFCQLLQQMKNKHSEQPEPDMITIFIGTWNMGNAPPPK
K
ITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKT
VAIHTLWNIRI
V
VLAKPEHENRISHICTDNVKTGIANTL
GNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNIL
R
FLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTW
EAETIIQKIKQQQYADLLSHDQLLTERREQKVF
L
HF
EEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSD
H
SPVFATFEAGVTSQFVSKN
GPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEE
G
SEGELVVKFGETLPK
LKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHH
G
ELTGHFQGEIKLQTSQGKTREKLY
DFVKTERDESSGPKTLKSLTSHDPMKQWEVTSRAPPCSGSSITEI
I
NPNYMGVGPFGPPMPLHVKQTLSPDQQPTAWSYDQPPKDSPLGPCRGESPPTPPGQPPISPKKFLPSTA
N
RGLPPRTQES
RPSDLGKNAGDTLPQEDLPLTKPEMFENPLYGSLSSFPKPAPRKDQESPKMPRKEPPPC
P
EPGILSPSIVLTKAQEADRGEGPGKQVPAPRLRSFTCSSSAEGRAAGGDKSQGKPKTPVSSQAPVPAKR
P
IKPSRSEINQQTPPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPLGRTAMQ




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser