NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS73797.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
73797.1 Public Homo sapiens 16 NME4 24 110 108 CCDS HistoryNCBI Gene:4833Re-query CCDS DB by CCDS ID:73797.1Re-query CCDS DB by GeneID:4833See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 73797.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000621774.4 ENSP00000479681.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000621774.4Link to Ensembl Protein Viewer:ENSP00000479681.1Re-query CCDS DB by Nucleotide ID:ENST00000621774Re-query CCDS DB by Protein ID:ENSP00000479681
Original member Current member NCBI NM_001286433.2 NP_001273362.1 Accepted alive Link to Nucleotide Sequence:NM_001286433.2Link to Protein Sequence:NP_001273362.1Re-query CCDS DB by Nucleotide ID:NM_001286433Re-query CCDS DB by Protein ID:NP_001273362Link to BLAST:NP_001273362.1

Chromosomal Locations for CCDS 73797.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 397223 397313 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 398990 399123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 399627 399739 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 400219 400342 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (462 nt):
ATGGGCGGCCTCTTCTGGCGCTCCGCGCTGCGGGGGCTGCGCTGCGGCCCGCGGGCCCCGGGCCCGAGCC
TG
CTAGTGCGCCACGGCTCGGGAGGGCCCTCCTGGACCCGGGAGCGGACCCTGGTGGCGGTGAAGCCCGA
T
GGCGTGCAACGGCGGCTCGTTGGGGACGTGATCCAGCGCTTTGAGAGGCGGGGCTTCACGCTGGTGGGG
ATG
AAGATGCTGCAGGTCTGGGAAGGGTACAATGTCGTCCGCGCCTCGAGGGCCATGATTGGACACACCG
AC
TCGGCTGAGGCTGCCCCAGGAACCATAAGGGGTGACTTCAGCGTCCACATCAGCAGGAATGTCATCCA
C
GCCAGCGACTCCGTGGAGGGGGCCCAGCGGGAGATCCAGCTGTGGTTCCAGAGCAGTGAGCTGGTGAGC
TGG
GCAGACGGGGGCCAGCACAGCAGCATCCACCCAGCCTGA


Translation (153 aa):
MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVG
M
KMLQ
VWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVS
W
ADGGQHSSIHPA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser