NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS73039.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
73039.1 Public Homo sapiens 1 PYCR2 24 110 108 CCDS HistoryNCBI Gene:29920Re-query CCDS DB by CCDS ID:73039.1Re-query CCDS DB by GeneID:29920See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 73039.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000612039.4 ENSP00000478165.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000612039.4Link to Ensembl Protein Viewer:ENSP00000478165.1Re-query CCDS DB by Nucleotide ID:ENST00000612039Re-query CCDS DB by Protein ID:ENSP00000478165
Original member Current member NCBI NM_001271681.2 NP_001258610.1 Accepted alive Link to Nucleotide Sequence:NM_001271681.2Link to Protein Sequence:NP_001258610.1Re-query CCDS DB by Nucleotide ID:NM_001271681Re-query CCDS DB by Protein ID:NP_001258610Link to BLAST:NP_001258610.1

Chromosomal Locations for CCDS 73039.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 225920455 225920620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 225921208 225921371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 225921552 225921644 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 225922204 225922383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 225923701 225923771 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 225924044 225924110 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (741 nt):
ATGAGCGTGGGCTTCATCGGGGCCGGCCAGCTGGCCTATGCTCTGGCGCGGGGCTTCACGGCCGCAGGCA
TC
CTGTCGGCTCACAAGATAATAGCCAGCTCCCCAGAAATGAACCTGCCCACGGTGTCCGCGCTCAGGAA
G
ATGGGTGTGAACCTGACACGCAGCAACAAGGAGACGGTGAAGCACAGCGACGTCCTGTTTCTGGCTGTG
AAG
CCACATATCATCCCCTTCATCCTGGATGAGATTGGGGCCGACGTGCAAGCCAGACACATCGTGGTCT
CC
TGTGCGGCTGGTGTCACCATCAGCTCTGTGGAGAAGGCATTCATGGCTCTGGACGCATTGGCTGATGG
T
GGGGTGAAGATGGGTTTGCCACGGCGCCTGGCAATCCAACTCGGGGCCCAGGCTTTGCTGGGAGCTGCC
AAG
ATGCTGCTGGACTCGGAGCAGCATCCATGCCAGCTTAAGGACAATGTCTGCTCCCCTGGGGGAGCCA
CC
ATCCACGCCCTGCACTTTCTAGAGAGTGGGGGCTTCCGCTCTCTGCTCATCAATGCAGTTGAGGCCTC
C
TGTATCCGAACACGAGAGCTACAGTCCATGGCCGACCAAGAAAAGATCTCCCCAGCTGCCCTTAAGAAG
ACC
CTCTTAGACAGAGTGAAGCTGGAATCCCCCACAGTCTCCACACTGACCCCCTCCAGCCCAGGGAAGC
TC
CTCACAAGAAGCCTGGCCCTGGGAGGCAAGAAGGACTAA


Translation (246 aa):
MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV
K
PHIIPFILDEIGADVQARHIVVSCAAGVTISSVEK
AFMALDALADGGVKMGLPRRLAIQLGAQALLGAA
K
MLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRT
RELQSMADQEKISPAALKK
T
LLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser