NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS73006.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
73006.1 Public Homo sapiens 1 ETNK2 22 109 92 CCDS HistoryNCBI Gene:55224Re-query CCDS DB by CCDS ID:73006.1Re-query CCDS DB by GeneID:55224See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 73006.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000367201.7 ENSP00000356169.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000367201.7Link to Ensembl Protein Viewer:ENSP00000356169.3Re-query CCDS DB by Nucleotide ID:ENST00000367201Re-query CCDS DB by Protein ID:ENSP00000356169
Original member NCBI NM_001297760.1 NP_001284689.1 Updated not alive Link to Nucleotide Sequence:NM_001297760.1Link to Protein Sequence:NP_001284689.1Re-query CCDS DB by Nucleotide ID:NM_001297760Re-query CCDS DB by Protein ID:NP_001284689
Current member NCBI NM_001297760.2 NP_001284689.1 Accepted alive Link to Nucleotide Sequence:NM_001297760.2Link to Protein Sequence:NP_001284689.1Re-query CCDS DB by Nucleotide ID:NM_001297760Re-query CCDS DB by Protein ID:NP_001284689Link to BLAST:NP_001284689.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001284689.1 394 Q9NVF9-2 394 100% 0 0

Chromosomal Locations for CCDS 73006.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 204134524 204134694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204137104 204137249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204140035 204140118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204141315 204141457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204146642 204146764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204149703 204149962 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 204151595 204151852 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1185 nt):
ATGGCTGTGCCCCCTTCGGCCCCTCAGCCGCGCGCGTCCTTTCACCTGAGGAGGCACACGCCTTGCCCGC
AG
TGCTCATGGGGCATGGAGGAGAAGGCGGCGGCCAGCGCCAGCTGCCGGGAGCCGCCGGGCCCCCCGAG
G
GCCGCCGCCGTCGCGTACTTCGGCATTTCCGTGGACCCGGACGACATCCTTCCCGGGGCCCTGCGCCTC
ATC
CAGGAGCTGCGGCCGCATTGGAAACCCGAGCAAGTTCGGACCAAGCGCTTCACGGATGGCATCACCA
AC
AAGCTGGTGGCCTGCTATGTGGAGGAGGACATGCAGGACTGCGTGCTGGTCCGGGTGTATGGGGAGCG
G
ACGGAGCTGCTGGTGGACCGGGAGAATGAGGTCAGAAACTTCCAGCTGCTGCGAGCACACAGCTGTGCC
CCC
AAACTCTACTGCACCTTCCAGAATGGGCTGTGCTATGAGTACATGCAGGGTGTGGCCCTGGAGCCTG
AG
CACATCCGTGAGCCCCGGCTTTTCAGGTTAATCGCCTTAGAAATGGCAAAGATTCATACTATCCACGC
C
AACGGCAGCCTGCCCAAGCCCATCCTCTGGCACAAGATGCACAATTATTTCACGCTTGTGAAGAACGAG
ATC
AACCCCAGCCTTTCTGCAGATGTCCCTAAGGTAGAGGTGTTGGAACGGGAGCTGGCCTGGCTGAAGG
AG
CATCTGTCCCAGCTGGAGTCCCCTGTGGTGTTTTGTCACAATGACCTGCTCTGCAAGAATATCATCTA
T
GACAGCATCAAAGGTCACGTGCGGTTCATTGACTATGAATATGCTGGCTACAACTACCAAGCTTTTGAC
ATT
GGCAACCATTTCAATGAGTTTGCAGGCGTGAATGAGGTGGATTACTGCCTGTACCCGGCGCGGGAGA
CC
CAGCTGCAGTGGCTGCACTACTACCTGCAGGCACAAAAGGGGATGGCCGTGACCCCCAGGGAGGTGCA
A
AGGCTCTACGTGCAAGTCAACAAGTTTGCCCTGGGTCCTAGCTGTGTGTCTTCCACAATGACTGCATCC
CTC
CAGTGCTGTAGAGTCGGAAACAGGCATGGGGAGATTGCCAGGCTGACCCTCTCTGGTCTGTTTCCAG
GC
GTCTCACTTCTTCTGGGCTCTCTGGGCCCTCATCCAGAACCAGTACTCCACCATCGACTTTGA


Translation (394 aa):
MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDPDDILPGALRL
I
QELRPHWKPEQVRTK
RFTDGITNKLVACYVEEDMQDCVLVRVYGERTELLVDRENEVRNFQLLRAHSCA
P
KLYCTFQNGLCYEYMQGVALEPEHIREPRLF
RLIALEMAKIHTIHANGSLPKPILWHKMHNYFTLVKNE
I
NP
SLSADVPKVEVLERELAWLKEHLSQLESPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFD
I
GNHFNEFA
GVNEVDYCLYPARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALGPSCVSSTMTAS
L
QCCRVGNRHGEIARLTLSGLFPGVSLLLGSLGPHPEPVLHHRL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser