NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS72887.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
72887.1 Public Homo sapiens 1 PDE4DIP 24 110 108 CCDS HistoryNCBI Gene:9659Re-query CCDS DB by CCDS ID:72887.1Re-query CCDS DB by GeneID:9659See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 72887.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000530472.5 ENSP00000482121.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000530472.5Link to Ensembl Protein Viewer:ENSP00000482121.1Re-query CCDS DB by Nucleotide ID:ENST00000530472Re-query CCDS DB by Protein ID:ENSP00000482121
Original member Current member NCBI NM_022359.8 NP_071754.3 Accepted alive Link to Nucleotide Sequence:NM_022359.8Link to Protein Sequence:NP_071754.3Re-query CCDS DB by Nucleotide ID:NM_022359Re-query CCDS DB by Protein ID:NP_071754Link to BLAST:NP_071754.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_071754.3 310 Q5VU43-8 310 100% 0 0

Chromosomal Locations for CCDS 72887.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 148808505 148808737 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 148863250 148863305 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 148868471 148868622 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 148889784 148889894 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 148929197 148929273 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 148931800 148931923 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 148932113 148932292 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (933 nt):
ATGAAGGGCACAGACAGCGGGTCCTGCTGCCGCCGCCGATGCGACTTTGGCTGCTGCTGTCGCGCGTCCC
GC
CGGGCTCACTACACGCCTTACCGGTCCGGGGACGCGACGCGAACCCCTCAGTCCCCACGGCAGACCCC
G
AGCCGGGAAAGACGGCGCCCGGAGCCAGCCGGGAGCTGGGCAGCAGCGGCCGAGGAGGAAGAAGCAGCT
GCG
GCGGCCACACCCTGGATGAGAGATTATTTTGCAGAGGATGATGGGGAGATGGTACCCAGAACGAGTC
AC
ACAGCAGCTTTTCTTAGTGACACTAAAGATCGAGGCCCTCCAGTGCAGTCACAGATCTGGAGAAGTGG
T
GAAAAGGTCCCGTTTGTGCAGACATATTCCTTGAGAGCATTTGAGAAACCCCCTCAGGTACAGACCCAG
GCT
CTTCGAGACTTTGAGAAGCACCTCAATGACCTGAAGAAGGAGAACTTCAGCCTCAAGCTGCGCATCT
AC
TTCCTGGAGGAGCGCATGCAACAGAAGTATGAGGCCAGCCGGGAGGACATCTACAAGCGGAACATTGA
G
CTGAAGGTTGAAGTGGAGAGCTTGAAACGAGAACTCCAGGACAAGAAACAGCATCTGGATAAAACATGG
GCT
GATGTGGAGAATCTCAACAGTCAGAATGAAGCTGAGCTCCGACGCCAGTTTGAGGAGCGACAGCAGG
AG
ACGGAGCATGTTTATGAGCTCTTGGAGAATAAGATCCAGCTTCTGCAGGAGGAATCCAGGCTAGCAAA
G
AATGAAGCTGCGCGGATGGCAGCTCTGGTGGAAGCAGAGAAGGAGTGTAACCTGGAGCTCTCAGAGAAA
CTG
AAGGGAGTCACCAAAAACTGGGAAGATGTACCAGGAGACCAGGTCAAGCCCGACCAATACACTGAGG
CC
CTGGCCCAGAGGGACAAGTAG


Translation (310 aa):
MKGTDSGSCCRRRCDFGCCCRASRRAHYTPYRSGDATRTPQSPRQTPSRERRRPEPAGSWAAAAEEEEAA
A
AATPWM
RDYFAEDDGEMVPRTSHTAAFLSDTKDRGPPVQSQIWRSGEKVPFVQTYSLRAFEKPPQVQTQ
A
LRDFEK
HLNDLKKENFSLKLRIYFLEERMQQKYEASREDIYKRNIELKVEVESLKRELQDKKQHLDKTW
A
DVENLNSQNEAELRRQFEERQQETEHVYELLENKIQLLQE
ESRLAKNEAARMAALVEAEKECNLELSEK
L
KGVTKNWEDVPGDQVKPDQYTEALAQRDK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser