NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS72760.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
72760.1 Public Homo sapiens 1 INPP5B 22 109 92 CCDS HistoryNCBI Gene:3633Re-query CCDS DB by CCDS ID:72760.1Re-query CCDS DB by GeneID:3633See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 17, NCBI annotation release 106, Ensembl annotation release 76

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 72760.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000373027.5 ENSP00000362118.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000373027.5Link to Ensembl Protein Viewer:ENSP00000362118.1Re-query CCDS DB by Nucleotide ID:ENST00000373027Re-query CCDS DB by Protein ID:ENSP00000362118
Original member NCBI NM_001297434.1 NP_001284363.1 Updated not alive Link to Nucleotide Sequence:NM_001297434.1Link to Protein Sequence:NP_001284363.1Re-query CCDS DB by Nucleotide ID:NM_001297434Re-query CCDS DB by Protein ID:NP_001284363
Current member NCBI NM_001297434.2 NP_001284363.1 Accepted alive Link to Nucleotide Sequence:NM_001297434.2Link to Protein Sequence:NP_001284363.1Re-query CCDS DB by Nucleotide ID:NM_001297434Re-query CCDS DB by Protein ID:NP_001284363Link to BLAST:NP_001284363.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001284363.1 749 P32019-3 749 100% 0 0

Chromosomal Locations for CCDS 72760.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 37862315 37862430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37864312 37864423 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37865761 37865888 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37866459 37866543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37868501 37868614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37872930 37873165 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37873993 37874155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37875606 37875716 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37878188 37878323 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37880085 37880194 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37882807 37882918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37885638 37885825 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37886888 37887004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37887351 37887465 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37888243 37888344 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37889557 37889724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37891358 37891454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 37931673 37931712 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2250 nt):
ATGTCTGCCGCCGCCGGCTCTCGGGAGCGCAACACTGCAGGTGGTTCTAACTTTGATGGTTTGAGACCAA
AT
GGGAAGGGAGTGCCTATGGACCAAAGCTCCAGGGGTCAAGATAAACCAGAAAGCTTGCAACCAAGACA
G
AATAAATCCAAGTCCGAAATTACTGACATGGTTCGCTCCTCCACTATCACAGTGTCGGACAAGGCTCAT
ATT
TTATCCATGCAGAAGTTTGGACTGCGAGATACAATTGTGAAATCACATCTACTACAGAAAGAAGAGG
AT
TACACCTATATCCAGAACTTCAGGTTTTTTGCGGGAACATACAATGTAAATGGGCAGTCCCCCAAAGA
A
TGCCTCCGGCTGTGGCTGAGCAATGGTATCCAGGCCCCAGATGTCTATTGTGTAGGGTTCCAGGAGCTT
GAT
CTGAGTAAGGAAGCTTTTTTCTTTCACGATACCCCAAAGGAGGAAGAGTGGTTCAAAGCTGTGTCAG
AG
GGTCTTCATCCAGATGCCAAATATGCAAAGGTGAAGCTTATCCGACTGGTTGGGATTATGCTGCTGTT
A
TATGTCAAACAGGAGCATGCAGCTTATATCTCAGAAGTGGAAGCCGAGACTGTGGGGACAGGAATCATG
GGG
AGGATGGGCAACAAGGGAGGCGTGGCGATCAGGTTCCAGTTCCACAACACCAGCATCTGCGTTGTGA
AT
TCTCACTTGGCAGCCCACATTGAAGAGTATGAGAGGAGGAACCAGGACTATAAGGACATTTGTTCTCG
A
ATGCAGTTTTGTCAGCCTGACCCAAGCCTTCCCCCTCTCACCATCAGCAACCATGATGTGATCTTGTGG
CTG
GGGGACCTCAACTACAGGATAGAAGAGCTGGATGTGGAAAAAGTGAAAAAGCTCATCGAAGAGAAGG
AC
TTTCAAATGCTGTATGCATATGATCAGCTGAAAATTCAGGTGGCCGCAAAGACTGTCTTTGAAGGCTT
C
ACAGAGGGTGAGCTCACATTCCAGCCTACTTACAAGTATGATACGGGCTCTGACGACTGGGATACCAGT
GAG
AAGTGCCGTGCTCCTGCCTGGTGTGATCGGATTCTCTGGAAAGGGAAGAACATCACTCAGCTGAGTT
AC
CAGAGCCACATGGCCCTGAAGACCAGTGACCACAAGCCTGTCAGCTCAGTGTTTGACATCGGGGTGAG
G
GTCGTAAATGACGAGCTTTACCGGAAGACACTGGAGGAAATTGTTCGCTCCCTGGATAAGATGGAAAAT
GCC
AACATTCCTTCTGTGTCCCTGTCCAAGCGAGAGTTCTGTTTTCAGAATGTGAAGTACATGCAATTGA
AA
GTAGAATCCTTTACAATTCATAATGGACAAGTACCCTGTCATTTTGAATTCATCAACAAGCCTGATGA
A
GAGTCTTACTGTAAGCAGTGGCTGAATGCCAACCCCAGCAGAGGCTTCCTCCTGCCAGATTCTGATGTT
GAG
ATTGACTTGGAGCTCTTCGTAAATAAGATGACAGCTACAAAGCTCAACTCGGGTGAAGACAAAATTG
AG
GACATTCTGGTTCTGCACTTGGACAGGGGAAAGGATTACTTTTTGTCTGTGTCTGGGAACTACCTGCC
C
AGCTGTTTTGGGTCTCCCATTCATACACTGTGTTACATGAGAGAGCCAATCTTGGACCTACCACTTGAA
ACC
ATTAGTGAGCTGACTCTGATGCCAGTATGGACTGGAGATGATGGGAGCCAGTTGGATAGCCCCATGG
AA
ATCCCCAAAGAGCTCTGGATGATGGTTGATTACCTGTACCGAAATGCTGTCCAGCAGGAAGATCTGTT
T
CAGCAACCAGGCCTGAGGTCAGAATTTGAACATATCAGGGACTGCTTGGATACTGGAATGATTGATAAC
CTC
TCTGCCAGCAATCATTCTGTAGCCGAAGCCCTGCTGCTTTTCCTGGAGAGCCTTCCAGAGCCTGTCA
TC
TGTTACAGCACCTACCATAACTGCTTGGAGTGTTCTGGCAACTACACAGCAAGCAAACAGGTCATTTC
T
ACTCTCCCCATATTCCACAAAAATGTCTTCCACTACTTGATGGCGTTTTTGCGAGAACTGCTGAAAAAT
TCA
GCAAAAAATCATTTGGATGAGAATATTCTAGCTAGCATATTTGGCAGCTTATTGCTTCGAAACCCAG
CT
GGTCACCAAAAGCTTGATATGACAGAGAAGAAGAAGGCTCAAGAATTTATTCACCAGTTCCTCTGCAA
C
CCACTCTGA


Translation (749 aa):
MSAAAGSRERNTAGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAH
I
LSMQKFGLRDTIVKSHLLQKEEDYTYIQNF
RFFAGTYNVNGQSPKECLRLWLSNGIQAPDVYCVGFQEL
D
LSKEAFFFHDTPKEEEWFKAVSEGLHPDAKYAK
VKLIRLVGIMLLLYVKQEHAAYISEVEAETVGTGIM
G
RM
GNKGGVAIRFQFHNTSICVVNSHLAAHIEEYERRNQDYKDICSRMQFCQPDPSLPPLTISNHDVILW
L
GDLNYRIEELDVEKVKKLIEEKDFQMLYAYDQ
LKIQVAAKTVFEGFTEGELTFQPTYKYDTGSDDWDTS
E
KCRAPAWCDRILWKGKNITQLSYQSHMALKTSDHKPVSSVFDIG
VRVVNDELYRKTLEEIVRSLDKMEN
A
NIPSVSLSKRE
FCFQNVKYMQLKVESFTIHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDV
E
IDLELFVNKMTATKLNSGEDKIEDILVLHLDRGKDYFLSVSGNYLPSCFGSPIHTLCYMREPILDLPLE
T
ISEL
TLMPVWTGDDGSQLDSPMEIPKELWMMVDYLYRNAVQQEDLFQQPGLRSEFEHIRDCLDTGMIDN
L
SASNHSVAEALLLFLESLPEPVICYSTYHNCLECSGNYTASKQVISTLPIFHKNVFHYLMAFLRELLKN
S
AKNHLDENIL
ASIFGSLLLRNPAGHQKLDMTEKKKAQEFIHQFLCNPL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser