NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS72342.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
72342.1 Public Mus musculus X Sytl5 23 108 98 CCDS HistoryNCBI Gene:236643Re-query CCDS DB by CCDS ID:72342.1Re-query CCDS DB by GeneID:236643See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 72342.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000086165.3 ENSMUSP00000083339.3 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000086165.3Link to Ensembl Protein Viewer:ENSMUSP00000083339.3Re-query CCDS DB by Nucleotide ID:ENSMUST00000086165Re-query CCDS DB by Protein ID:ENSMUSP00000083339
Original member Current member NCBI NM_001290728.1 NP_001277657.1 Accepted alive Link to Nucleotide Sequence:NM_001290728.1Link to Protein Sequence:NP_001277657.1Re-query CCDS DB by Nucleotide ID:NM_001290728Re-query CCDS DB by Protein ID:NP_001277657Link to BLAST:NP_001277657.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001277657.1 731 Q80T23-2 731 100% 0 0

Chromosomal Locations for CCDS 72342.1

Assembly GRCm38.p6 (GCF_000001635.26)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 9885661 9885779 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9905518 9905727 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9913903 9914018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9915506 9915614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9932733 9932867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9943040 9943181 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9948812 9948941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9951578 9951684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9956359 9956448 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9960014 9960192 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9961733 9961832 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9963591 9963752 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9986796 9986904 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9988551 9988686 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9992889 9993097 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X
X 9994401 9994543 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2196 nt):
ATGTCTAAGAACTCGGAGTTCATCAATCTGTCATTTTTATTAGATCATGAGAAGGAAATGATACTGGGAG
TC
CTAAAGAGAGATGAATATTTGAAAAAGGTGGAAGACAAGAGGATAAGGAAGCTGAAAAATGAACTCTT
A
GAAGCAAAGCGTAGGAGTGGGAAGACTCACCAAGAGGCCAGTAGAGTCTGCGTTCACTGTCACAAAACC
CTT
GGCCTCATCTTTGACCGGGGAGATCCATGCCAAGCCTGCTCACTCAGGGTATGCAGTGAGTGTCGAG
TC
ACCGGACTTGATGGCAGCTGGAAGTGCACTGTCTGTGCCAAAGTCGCGCAGCTAAGGATTATAAGTGG
A
GAATGGTTCTTGGAAGAAAAGGCAAAGCGTTTCAAGCAAGTCAATGTTCTGGGCACTGATGTCGTTCGA
CAG
TCCATCTTAAGAAGAAGTCCAGGGTCTGAAGAAACACAAAACCAAGAGCAAGCACAACAATGTGTAG
AC
AAGTCAGATACTTTGTCTTCTGTCAGGCAGAAGACAACTCATGATGGCCCAAAGAAGAAGGGTTTTCT
T
CTTAGCAAGTTCAGATCAGCAACCAGAGGAGAAATCAGAACTCCAAAACCTGAAAGCGGAAGGAGCTAT
AGC
TTGGACTTAGACAGTCAAAATCTTCAGAGTTTCAAGTCAGCCTCTGGTTCAGACAGGGGAAGTACCA
CT
TCATCAGATCTCATTGACCAGGAGGCTGGACGAAGAACATCAAAAAGCAGCTACAGCAACGGTGGAAT
C
CCAGTTACTCAGAGGTCACCAGTCCCAAGTGCTCATAGTGTGACCTCCATCAACAGCAGAGAACATGGT
TTT
GAAAATTCCATGGCTTTGGCTACCATTGAAAACACCTGTGAAGAGCTCACAAAGAGTCACCGCAGAA
AC
ACATCCGGTACACCCTCCATAGCGGTGTCTGGCACCTCACTCTCCTCAGAGCGGAGTCGATCTGAGGT
A
GATTTGAGTGAGTCATTTGCGGAAGACTTAGAGGACACTTCAAGCATAAGAAGCAGATCTGTCCCTGGG
GCT
TTAGACAAAGACTTGAACTCCTTAGAAGACACTGAAGACGGTGTTGACTTAGTGTCCTCCAGGTTTT
CT
GCAAATACCCACAGTCTGGCAAGTGGATTGTCAACTACTAGCCTTAACAGCATGATGAGTGTTTACAG
T
GAAACGGGAGACTATGGCAACGTGAAAGTCACCGGTGAGATCCTTCTCCACATCAGCTACTGCTACAAA
ACC
GGCGGGCTATACATTTTTGTCAAGAGCTGCAGAAACCTGGCCACAGGAGATGAAAAGAAACAGAGGA
CA
GATGCTTATGTCAAGTCATACCTTCTTCCAGACAAGTCCCGAAACAACAAGCGTAAGACCAAAATCAG
A
ACGGGTACCAATCCAGAATTCAACGAAACATTAAAGTATACCATCAGCCACACCCAGCTGGAAACAAGA
ACT
CTGCAGCTCTCAGTCTGGCACTATGATCGGTTTGGACGCAACAGTTTCCTGGGAGAGGTGGAGATTG
CT
TTTGACTCATGGAACTTTGAAAATCCATGTGATGAGTGGTTTGTGCTTCAGCCGAAGGTGGAGTTGGC
T
CCTGATATTAGCCTTCAATACAAAGGAGAGCTAACCATTGTTTTGCGTTATATTCCTCCAGAGGAGAAC
CTA
ATATTCCCAGCAGGACAGCGTCAAGAAAAGAAGATCTTTAAAAGGGGAAAGAAGAAAGAGTCATCTT
CC
ATTTCTGGGGGAATACTTGAAGTGTTCATCAAAAAAGCAAAGAATCTGACAGCAGTAAAATCAGGAGG
C
ACTTCTGACAGCTTCGTCAAGGGCTACCTGCTTCCTGATGATAACAAAGCCACCAAGCACAAAACTGCT
GTT
GTAAAAAAGAGTGTCAATCCTGAGTGGAACCATACGTTCATATTCAGTGGCCTGTATCCTCAGGATA
TA
AAGAATGCTTGCCTAGAACTCACCATCTGGGACAAAGAGGCCTTTTCCAGCAACGTCTTTCTAGGAGG
T
GTTCGTTTAAATTCTGGAAGTGGTATGAGCTACGGTAAAACTGTGGACTGGATGGACTCTCATGGGGAA
GAG
CAACGCCTTTGGCAAAAGATGGCTGACAACCCTGGGACATCTGTAGAGGGGGTTCTCATGCTACGTT
CC
AGCATGGCGAAATGTAGGCTCTGA


Translation (731 aa):
MSKNSEFINLSFLLDHEKEMILGVLKRDEYLKKVEDKRIRKLKNELLEAKRRSGKTHQEASRVCVHCHKT
L
GLIFDRGDPCQACSLRVCSECRVTGLDGSWKCTVCAKV
AQLRIISGEWFLEEKAKRFKQVNVLGTDVVR
Q
SILRRSP
GSEETQNQEQAQQCVDKSDTLSSVRQKTTHDGPKKKGFLLSKFRSATRGEIRTPKPESGRSY
S
LDLDSQNLQSFKSASGSD
RGSTTSSDLIDQEAGRRTSKSSYSNGGIPVTQRSPVPSAHSVTSINSREHG
F
ENSMALATIENTCEELTKSHRRNTSGTPSIAVSGTSLSS
ERSRSEVDLSESFAEDLEDTSSIRSRSVPG
A
LDKDL
NSLEDTEDGVDLVSSRFSANTHSLASGLSTTSLNSMMSVYSETGDYGNVKVTGEILLHISYCYK
T
GGLYIFVKSCRNLATGDEKKQRTD
AYVKSYLLPDKSRNNKRKTKIRTGTNPEFNETLKYTISHTQLETR
T
LQLSVWHYDRFGRNSFLGEVEIAFDSWNFENPCDEWFVLQPK
VELAPDISLQYKGELTIVLRYIPPEEN
L
IFPAGQRQ
EKKIFKRGKKKESSSISGGILEVFIKKAKNLTAVKSGGTSDSFVKGYLLPDDNKATKHKTA
V
VKKSVNPEWNHTFIFSGLYPQDIKNACLELTIWDKEAFSSNVFLGGVRLNSGS
GMSYGKTVDWMDSHGE
E
QRLWQKMADNPGTSVEGVLMLRSSMAKCRL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser