NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS7106.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
7106.1 Public Homo sapiens 10 OLAH 22 109 92 CCDS HistoryNCBI Gene:55301Re-query CCDS DB by CCDS ID:7106.1Re-query CCDS DB by GeneID:55301See the combined annotation on chromosome 10 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 7106.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000378217.3 ENSP00000367462.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000378217.3Link to Ensembl Protein Viewer:ENSP00000367462.3Re-query CCDS DB by Nucleotide ID:ENST00000378217Re-query CCDS DB by Protein ID:ENSP00000367462
Original member NCBI NM_018324.2 NP_060794.1 Updated not alive Link to Nucleotide Sequence:NM_018324.2Link to Protein Sequence:NP_060794.1Re-query CCDS DB by Nucleotide ID:NM_018324Re-query CCDS DB by Protein ID:NP_060794
Current member NCBI NM_018324.3 NP_060794.1 Accepted alive Link to Nucleotide Sequence:NM_018324.3Link to Protein Sequence:NP_060794.1Re-query CCDS DB by Nucleotide ID:NM_018324Re-query CCDS DB by Protein ID:NP_060794Link to BLAST:NP_060794.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060794.1 318 Q9NV23-2 318 100% 0 0

Chromosomal Locations for CCDS 7106.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 15047289 15047320 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 15049635 15049765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 15056824 15056982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 15061724 15061862 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 15064403 15064502 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 15065584 15065753 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 15071795 15071877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10
10 15073087 15073229 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (957 nt):
ATGGAGAGAGGAGACCAACCTAAGAGAACCAGGAATGAAAACATTTTCAACTGCTTATACAAAAACCCTG
AG
GCAACTTTTAAGCTGATTTGCTTTCCCTGGATGGGAGGTGGCTCCACTCATTTTGCCAAATGGGGCCA
A
GATACTCATGATTTGCTGGAAGAGACAGCATCTCACCATGTTGCCAAGGCTGGTCTCAAACTCCGGCGC
TCA
AGTGATCCTCCTGCTTCAGCCTACCCATGTGCTGGCGTGAGCCACCGTAGGCGTGAGCCACCGTGCC
TG
GCCAAAATTCTTGGTCTATTCTGGATTCTAATTTTTTTTATGCACTCCTTAAGGCTTCCTGGAAGAGA
A
AGCAGAGTTGAAGAACCTCTTGAAAATGACATCTCCCAGTTAGTTGATGAAGTTGTTTGTGCTCTGCAG
CCA
GTCATCCAGGATAAACCATTTGCATTTTTTGGCCACAGTATGGGATCCTACATTGCTTTTAGGACTG
CA
CTAGGTCTAAAAGAAAACAATCAACCAGAACCATTGCATTTATTTTTGTCAAGTGCAACTCCTGTACA
T
TCAAAGGCCTGGCATCGCATTCCCAAAGATGATGAATTGTCAGAAGAACAAATAAGTCATTACCTTATG
GAA
TTTGGAGGCACCCCCAAGCATTTTGCTGAAGCCAAGGAATTTGTGAAACAATGTAGTCCCATCATAA
GG
GCAGATCTGAACATTGTTAGAAGTTGCACCTCTAACGTACCATCTAAGGCTGTTCTTTCCTGTGACTT
G
ACATGTTTTGTTGGATCTGAAGACATAGCAAAGGACATGGAAGCCTGGAAAGATGTAACCAGTGGAAAT
GCT
AAAATTTACCAGCTTCCAGGGGGTCACTTTTATCTTCTGGATCCTGCGAACGAGAAATTAATCAAGA
AC
TACATAATCAAGTGTCTAGAAGTATCATCGATATCCAATTTTTAG


Translation (318 aa):
MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEETASHHVAKAGLKLRR
S
SDPPASAYPCAGVSHRRREPPCLAKILGLFWILIFF
MHSLRLPGRESRVEEPLENDISQLVDEVVCALQ
P
VIQDKPFAFFGH
SMGSYIAFRTALGLKENNQPEPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLM
E
FGGTPKHFAEAKEFVKQCSPIIRADLNIVRSC
TSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGN
A
KIYQLPGGHFYLLDPANEKLIKNYIIKCLEVSSISNF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser