NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq

Report for CCDS69921.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
69921.1 Public Mus musculus 1 Mroh2a 21 106 86 CCDS HistoryNCBI Gene:100040766Re-query CCDS DB by CCDS ID:69921.1Re-query CCDS DB by GeneID:100040766See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 16, NCBI annotation release 104, Ensembl annotation release 75

Review status: Reviewed (by RefSeq and Havana)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 69921.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000113130 ENSMUSP00000108755 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000113130Link to Ensembl Protein Viewer:ENSMUSP00000108755Re-query CCDS DB by Nucleotide ID:ENSMUST00000113130Re-query CCDS DB by Protein ID:ENSMUSP00000108755
Original member Current member EBI,WTSI OTTMUST00000049203 OTTMUSP00000022758 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000049203Link to Vega Protein Viewer:OTTMUSP00000022758Re-query CCDS DB by Nucleotide ID:OTTMUST00000049203Re-query CCDS DB by Protein ID:OTTMUSP00000022758
Original member Current member NCBI NM_001281466.1 NP_001268395.1 Accepted alive Link to Nucleotide Sequence:NM_001281466.1Link to Protein Sequence:NP_001268395.1Re-query CCDS DB by Nucleotide ID:NM_001281466Re-query CCDS DB by Protein ID:NP_001268395Link to BLAST:NP_001268395.1

Chromosomal Locations for CCDS 69921.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 88228068 88228146 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88228227 88228408 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88230342 88230473 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88230626 88230788 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88232244 88232342 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88233317 88233468 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88234002 88234145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88234970 88235062 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88235190 88235268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88235373 88235486 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88236655 88236731 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88237473 88237592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88237845 88237955 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88238894 88239041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88240119 88240159 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88240679 88240820 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88241071 88241123 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88241543 88241650 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88242404 88242523 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88242669 88242791 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88243931 88244083 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88244944 88245066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88245988 88246067 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88247136 88247244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88247748 88247843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88248552 88248656 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88249703 88249826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88250265 88250383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88251245 88251397 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88252336 88252490 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88254858 88255017 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88255090 88255283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88255543 88255680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88256057 88256171 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88256400 88256549 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88256651 88256833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88257710 88257865 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88258583 88258714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88259119 88259221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88259530 88259595 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 88259905 88260026 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (5016 nt):
ATGAAAGAAGCCACTGAGTTGAATGAAGACATGTTGGAGGAAGCAGAGCATCTGGCACTTCTAGAGCCAG
AG
GATGATGGTACATTCTTCCAAGTCACCAACCTCCTGAACATCATGGACAGTGAATCAGCAAAGACAGA
C
ACCACAGGGCCAGGCCTGGACATGCGGAAGACCTTGGCTTCAGTGATAATCACAGAGAAGGCTACCACG
GAT
CCCTGTGTAGTGATGAACGCGCTCATCCGCTGCCTGCAGATGCCAGAGATTTCTACCCAACGCAAAA
TG
AACATCTACAACATCATGCAGGAGATCATCCAGCAGGAAGGGGAGATGGAGGAGCACTGTATACAAAG
G
CTGGTGGCCATTGCCTCCAAGCAGATGCGGGATATCACAGAGGCGGAGGATTTTGAGACCGCCGAGGTG
GCC
AGTGAGACTCTAGTGGCTCTGTCCCGAAACCACTTCAGCTTGGTCATGTATGAACTGCAGCATCATC
TC
AAGCCTCTCAACCTCACTGACGAGTTTGTCATTGTCACCCTGGCCAAGCTGGCCAATGGCAATGTGTT
T
GAATTCATGCCCTACATGGGCATCACCCTGGCTACCATATTCACGATGTTGAGACTTGCCAACGAAGCC
AAG
ATGCGCCAGGTGATCTGTAGTGCCATGGAGACGTTCTGTGAGACGGTGCAGTTTTACCTGAGGCACC
TG
GAGGACAGCCTGTATCCCGTGATGACGGAGGACCAGTTTGCTGTGAAGCTCTTCCCAATGTACCGATA
C
TTCGTGACCGTGTGGCTGCGCCACCAGGACCTTGAGGTGAAACTGGGAGTCATCAAGTCTCTCAGGCCC
ATG
CTGAGCCTTCTCCTGCCTAATGACGACCTGAGGGAACAGGTGTATGACTATATCCCCCTGCTGCTGG
CT
GAGTTCCAGGGTGGCCTGGAGGCTCTCTTCGTCACACAGGTCTTGAGGCAGATTCTAGAAGCATCGGT
T
ACCACCAACACCCCTATCCCCCCGATGCTGCTACACCCCATTTTCACAGAGTTGCACGTCCAGGTGTGC
TCC
AAGGCCCCAGCCCAGCAGCAGTTCAGCAGTCAGAACCTGATGGAGATCGTGCACTGCTTCATAGCCC
TG
GCCCGCTCCTACCCCAAGGAACTGATGAAGTTCTTCTTCAGCCAGGTGGAGATGAGCAAAGAGGCTGT
C
CGTGTGGGGACACTGGCCCTGATCAGGGCAGTAGTGAGCGCAGATGACCCCAAAATTAATATCAAGACC
ATC
TACCTGGCCATCCGCGTCGTCAAGAACACTCTCTCTGACACTCGGTCCAAGGTACGGATGGCAATTC
TG
CGAATCATTGGCCAGCTGGTTCTGTCAGGCTTCCAGGAAAAGATCAAAGGCTGGGGTCTGAAATATGT
G
TCTGTCCAGCTCACCTTATCTACCTACAAGCTGACAAATCGACGGGAATGCTTTTATCAGAGGGATTTG
GAA
GAGAAGATGGTTCACAAAGTAACCATGGATACTGTAAAGATCATAACTTCTTCTATCAGCGGCATGA
CC
AATGAGTTCTGGGTGAGGCTCCTGTGCTACATCATGGAGACAGACTACACCGAGGCACTGACCCCCAT
C
TGCATCAGCCTCACGAACCTGGCCGAGAACCAAATTCATGGCAAAGACACGGAGGCTGGAATAGCTGGA
AAG
AGCAAGCATGTGGACTTGCCTGCACCCCAGAAGCTGCTGGCCCGTCTCCTGGTGCTGATGTCATCAC
CC
TATAAAGGAGAAGGCCGGGGGATTGCCATGCTCAACCTCCTGCGGACCCTAAGCCAGAGCATTGCTCC
T
TCCATGGCTGACATGTGGGAGCAGGAGATCCCTCTGCTAGTCCAGTACCTGGAAGAGCACACTGAGTTT
ACC
TGGAACCAGAAGACCTGGGAAGATATGCTGATTCAGTTTCTGAGAAACTCCCTCAAGAAGACCCGTG
GG
ACCAGCTGGAGCCTACGGCTCAGCAAAGAGCTGAACAACCAGATCGAGACCTTCGACAGCCCCTCCTT
G
GAAAAGGGTTTTCTGTACAGGGCCCTGGGTTTCACCTTAGGCATGGGTCTGGAGGCCGACAGGGTGGAA
GTG
CTATTATTGGAGCTGCTGTACAAGACAGACTACAGCAATGATTTTGACCGGGAGGGCGTCATCCTGT
GC
TTTGGACTGTGTGCCCGGGGCCAGGTAAAGACAGTGTTGAATGTGCTTCAGGACTTTGAGGAGAGGAT
C
CAGGAGTCGGAACAGTCCTGGCAGATCGGTGCCTGGAGGAAAGACCACCCCTGGAGGCGAGAGACGGTG
AAG
AGTGCCCTAATGGTGATGTACAGCTGTGTGTCCTCTTACTGCCACCCCCAGATGCTCCTCACCCACG
TG
GACAGCCCCATCACCTCTAAGATCATCCACCACTACTCCAGCAGCTGCCAGGACATCAGCCTCAAAAT
G
GCCTTCATGAAGAGTGTTGTGCAGGTCACCAACGCCATCAAAAGCATCCAAGACCCAGAGGACTTCCAG
TTT
GCCCACAAATCTGCTCTTACTGGCCTCATAGTTGTGATCATCAAAGCAGAACCACCTGACCACTTGG
TT
TCTCCCGTGAGGTCGATGGCAATGGATGCTCTCTCACAACTAAGCACGATGAAGCCTTTCTACTCTCC
A
GAGGAAAGCACAGAGTTGATGGATATCAGCATACACACCGTTATCTCCCTCCAACCCCCAGGGGAAGAC
AAT
GAGTCTGTTAAGACCCTGTATGCAAATACCATGAGTTCCCTAAAGCAGCTGATGGAGGGCCTCCTGC
AG
AGACAGCTGGACCCCAAGGGGCTGCAGGACACTGTGCATCTCCTGGAGAAGTGGATCTTGTCAGAGAA
A
GAGTGGGAACGGGAGAAAGCCATGGCCCTCCATCTCCATCTCATGCAGATCTACGTTCAAAGTATTGGT
GTC
TGTATCCCGCTGAAGCTGGGGCAGTTTGGAGTACTGGTTGGACTCATCGCTCCATGTACCTGTGATG
CC
CACAGAAGAACCCGCTTGGCCTCGATTAACGTCCTGTCCAGTCTGCTAGATCTTCATGTAAGCCAGAC
G
TGCTCTTTATGGGGAACTTCCAAGGAGCAGGAGCTGCAGAAATGTAAGGAGGACCTCCAGGACACCGAC
ATG
AACAAGATTTCCAGTGCTTCCTCCAGAGTCGCCAAGGTGGTTTGCCCAGAGTTTAACTGCGACGAGG
TT
GTCTCTCTCATCCAGAAGCTCTGTGAGAACATTGGGGCCATGGACCTGCAGCATGACAGGGCTGCTGT
C
ACCTGGATAGGCATCTTCCTCCAGATGCGGGTCAAGGAGCTGGAGGACAAGGTGGCTGAGATACTGGGT
GCC
ATCTTGGTTCACCTGCCAGTGGTGGATCACCCAGAGGTGAGGCGACATCTCATTGAAGGCATCCTCC
TG
CTGGCACACTACCACCAGGAGACCGTCCTCACATCACTTCTGAGACAGCCACTGCCCATGGAAAGCCA
T
CTGACAGAGGTGTGGCTGGCCGTGGCTGAGAATGTCCCCTTCGCACGGACCATGCTCCATGGCTTGCTG
GGC
CGGCTGCAGTCGAGGTTCACTGCCAAGATAAATGCCACCTCCAAGGCTGACATCTGGCGCCTGGCCG
CT
GTGGACCCTCTGATGACGCTGTGTACCATCCAGCTCCTCATGGAAAAGATGGACCAGGATGACAAATT
T
CCAGACCTGTTTCCTGACCTGCTGTATACCTTCCTGCTGCAGCTTGGCAGCAGCCATGGGCCAGAAGCT
GCC
TCCCCTGTCCTGAAAACCTGGAGACTGGTTCACACAGGGCCACTGCCCCAGGAGATGACCCTGCAGA
G
G
ATCACTATCAAATCCATGCAGCTTTTGGTCAAGAGGATCAACAGAGAGCCCCTGGAGCAGGCCTTGGA
G
GAGCAGTCTGTGTGGTCCCTGCTGGAGAACGGAGGCACCTTCCTTGAGGGAGTGAGCCTGATGGCCAGG
CTG
TGCATGCAGAACATGGAGAACTACATGCAGAGGCTGGCAGAGCTGGTGCTCACGGGCATGGGCTCCG
AG
ATCCTGAGCTGCTGCATCAGCAGCACGGCCATCTGTGTAGAATTCATGAGCGACCCAGTTCTGCACCA
G
GAGAAGCTGCTGAGGCCGGTGGTGCTGATGCTGGAGAAGGGTGCAGGGCAGGACAAAGATGAGACCTTG
CAG
GTGCTCTCTCTGCGTGCCTTGGGCAACATGGCTCTCGGTGCTCCCCGGAAGGTGAAGCAGTATCGAA
AA
CTCCTGCTGGAGAAGTGCCTGGGCTCCCTGCAGGGGCAGGTGAGCAGCAGTGCCATGGCGGAAGGCAT
G
GAGGCCCTCACCAAGGTCCTGGCTGAGCTCCGAGAGGGCGATATAGGGTCTTCTTTTGAAGCCATCTCT
AAG
CAGTGCAGAGCTTTCTTCGACAACGAAAGCGAGCTGCTACGGTTGAAGGCCTTTGTTCTCTTTGGGA
AG
CTTACAAAAGTGGTTGGGATTTCCAAGAAGCATTTCTTCAAAGGGGAGGTGAAGAGAGGCTGGGTCTC
C
CTCCTGCTGCACTGCCAGGACCCCTGCCCCAGCGTGGCCCAGGCATGTGTGGCCACCATGTTTCAGTGT
GTG
CATTTCTGGGGCTGGAAGTCCCTGGAGAGTTCCTTTGGTCACAGTAACGACAGCATCAATGAACAGA
TG
ACAGTTTTTCAGACAAACATGTGCTCCGTCCTGGCCCAGAAAAAGCCTGCTGTTCTCTGTGGCTTCCT
G
TTGGAAACAACAGTCTTCATGAAAAACAATCTGTCAAGGATCAGAATTGCTGCCTGCAACTTGGCGGGA
ATT
ATTATGAAGCAGCTGTCTGCCCATTATCTGAAAAAGATGGACCTTGTGGGACTTCGCAATTCTCTCC
AG
GACCTGCAGCTAGACTCAGACGCTGGGGTCAGGAGGGCAGCCTTGGAGACCCTCAAAGTCCTGGACAG
C
TGCAATCAGCACTGGCTCTTAGCGTCACCCAGAGGACTGCCGTAA


Translation (1671 aa):
MKEATELNEDMLEEAEHLALLEPEDDGTFFQVTNLLNIMDSESAKTDTTGPGLDMRKTLASVIITEKATT
D
PCVVMNALIRCLQMPE
ISTQRKMNIYNIMQEIIQQEGEMEEHCIQRLVAIASKQMRDITEAEDFETAEV
A
SETLVALSRNHFSLVMYELQHHLKPLNLTDEFVIVTLAKLANGN
VFEFMPYMGITLATIFTMLRLANEA
K
MRQVICS
AMETFCETVQFYLRHLEDSLYPVMTEDQFAVKLFPMYRYFVTVWLRHQDLEVKLGVIKSLRP
M
LSLLLPNDDLREQVYDYIPLLLAEFQGGLEALFVTQ
VLRQILEASVTTNTPIPPMLLHPIFTELHVQVC
S
KAPAQQQFSSQNLMEIVHCFIAL
ARSYPKELMKFFFSQVEMSKEAVRVGTLALIRAVVSADDPKINIKT
I
YLAIRVVKNTLSDTRSK
VRMAILRIIGQLVLSGFQEKIKGWGLKYVSVQLTLSTYKLTNRRECFYQRDL
E
EKMVHKVTMDTVKIITSSISGMTN
EFWVRLLCYIMETDYTEALTPICISLTNLAENQIHGKDTEAGIAG
K
SKH
VDLPAPQKLLARLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWEQEIPLLVQYLEEHTEF
T
WNQKTWEDMLIQ
FLRNSLKKTRGTSWSLRLSKELNNQIETFDSPSLEKGFLYRALGFTLGMGLEADRVE
V
LLLELLYKTDYSNDFDRE
GVILCFGLCARGQVKTVLNVLQDFEERIQESEQSWQIGAWRKDHPWRRETV
K
SALMVMYSCVSSYCHPQMLLTHVDSPITSKIIHHYSSSCQ
DISLKMAFMKSVVQVTNAIKSIQDPEDFQ
F
AHKSALTGLIV
VIIKAEPPDHLVSPVRSMAMDALSQLSTMKPFYSPEESTELMDISIHTVISLQPPGED
N
ESVK
TLYANTMSSLKQLMEGLLQRQLDPKGLQDTVHLLEKWILSEKEWEREKAMALHLHLMQIYVQSIG
V
C
IPLKLGQFGVLVGLIAPCTCDAHRRTRLASINVLSSLLDLHVSQTCSLWGTSKEQELQKCKEDLQDTD
M
NKISSASSRVAK
VVCPEFNCDEVVSLIQKLCENIGAMDLQHDRAAVTWIGIFLQMRVKELEDKVAEILG
A
ILVHLPVVDHPEVRRHLIEGILLLAHYHQETVLTSLLRQPLPME
SHLTEVWLAVAENVPFARTMLHGLL
G
RLQSRFTAKINATSKADIWRLAAVDPLM
TLCTIQLLMEKMDQDDKFPDLFPDLLYTFLLQLGSSHGPEA
A
SPVLKTWRLVHTGPLPQEMTLQ
RITIKSMQLLVKRINREPLEQALEEQSVWSLLENGGTFLEGVSLMAR
L
CMQNMENYMQRLAELVLTGMGSEILSCCISSTAICVE
FMSDPVLHQEKLLRPVVLMLEKGAGQDKDETL
Q
VLSLRALGNMALGAPRK
VKQYRKLLLEKCLGSLQGQVSSSAMAEGMEALTKVLAELREGDIGSSFEAIS
K
QCRAFFDN
ESELLRLKAFVLFGKLTKVVGISKKHFFKGEVKRGWVSLLLHCQDPCPSVAQACVATMFQC
V
HFWGWKSLESSFGHSNDSINEQMTVFQTNMCSVL
AQKKPAVLCGFLLETTVFMKNNLSRIRIAACNLAG
I
IMKQLSAHYLKKMDLVGLRN
SLQDLQLDSDAGVRRAALETLKVLDSCNQHWLLASPRGLP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser