NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6956.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6956.1 Public Homo sapiens 9 TSC1 22 109 92 CCDS HistoryNCBI Gene:7248Re-query CCDS DB by CCDS ID:6956.1Re-query CCDS DB by GeneID:7248See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6956.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000298552.8 ENSP00000298552.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000298552.8Link to Ensembl Protein Viewer:ENSP00000298552.3Re-query CCDS DB by Nucleotide ID:ENST00000298552Re-query CCDS DB by Protein ID:ENSP00000298552
Original member Current member EBI,WTSI ENST00000440111.6 ENSP00000394524.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000440111.6Link to Ensembl Protein Viewer:ENSP00000394524.2Re-query CCDS DB by Nucleotide ID:ENST00000440111Re-query CCDS DB by Protein ID:ENSP00000394524
Original member Current member EBI,WTSI ENST00000643875.1 ENSP00000495158.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000643875.1Link to Ensembl Protein Viewer:ENSP00000495158.1Re-query CCDS DB by Nucleotide ID:ENST00000643875Re-query CCDS DB by Protein ID:ENSP00000495158
Original member Current member EBI,WTSI ENST00000646625.1 ENSP00000496263.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000646625.1Link to Ensembl Protein Viewer:ENSP00000496263.1Re-query CCDS DB by Nucleotide ID:ENST00000646625Re-query CCDS DB by Protein ID:ENSP00000496263
Original member Current member NCBI NM_000368.4 NP_000359.1 Accepted alive Link to Nucleotide Sequence:NM_000368.4Link to Protein Sequence:NP_000359.1Re-query CCDS DB by Nucleotide ID:NM_000368Re-query CCDS DB by Protein ID:NP_000359Link to BLAST:NP_000359.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000359.1 1164 Q92574-1 1164 100% 0 0

Chromosomal Locations for CCDS 6956.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 132896235 132896754 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132897184 132897345 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132897423 132897610 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132900715 132900837 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132901589 132901699 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132902605 132902787 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132903651 132903817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132904411 132904454 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132905581 132906139 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132906731 132906835 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132907301 132907370 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132910571 132910692 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132911002 132911113 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132911453 132911568 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132912282 132912457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132921363 132921436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132921819 132921973 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132923348 132923492 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132925587 132925739 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132927201 132927304 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 132928767 132928872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3495 nt):
ATGGCCCAACAAGCAAATGTCGGGGAGCTTCTTGCCATGCTGGACTCCCCCATGCTGGGTGTGCGGGACG
AC
GTGACAGCTGTCTTTAAAGAGAACCTCAATTCTGACCGTGGCCCTATGCTTGTAAACACCTTGGTGGA
T
TATTACCTGGAAACCAGCTCTCAGCCGGCATTGCACATCCTGACCACCTTGCAAGAGCCACATGACAAG
CAC
CTCTTGGACAGGATTAACGAATATGTGGGCAAAGCCGCCACTCGTTTATCCATCCTCTCGTTACTGG
GT
CATGTCATAAGACTGCAGCCATCTTGGAAGCATAAGCTCTCTCAAGCACCTCTTTTGCCTTCTTTACT
A
AAATGTCTCAAGATGGACACTGACGTCGTTGTCCTCACAACAGGCGTCTTGGTGTTGATAACCATGCTA
CCA
ATGATTCCACAGTCTGGGAAACAGCATCTTCTTGATTTCTTTGACATTTTTGGCCGTCTGTCATCAT
GG
TGCCTGAAGAAACCAGGCCACGTGGCGGAAGTCTATCTCGTCCATCTCCATGCCAGTGTGTACGCACT
C
TTTCATCGCCTTTATGGAATGTACCCTTGCAACTTCGTCTCCTTTTTGCGTTCTCATTACAGTATGAAA
GAA
AACCTGGAGACTTTTGAAGAAGTGGTCAAGCCAATGATGGAGCATGTGCGAATTCATCCGGAATTAG
TG
ACTGGATCCAAGGACCATGAACTGGACCCTCGAAGGTGGAAGAGATTAGAAACTCATGATGTTGTGAT
C
GAGTGTGCCAAAATCTCTCTGGATCCCACAGAAGCCTCATATGAAGATGGCTATTCTGTGTCTCACCAA
ATC
TCAGCCCGCTTTCCTCATCGTTCAGCCGATGTCACCACCAGCCCTTATGCTGACACACAGAATAGCT
AT
GGGTGTGCTACTTCTACCCCTTACTCCACGTCTCGGCTGATGTTGTTAAATATGCCAGGGCAGCTACC
T
CAGACTCTGAGTTCCCCATCGACACGGCTGATAACTGAACCACCACAAGCTACTCTTTGGAGCCCATCT
ATG
GTTTGTGGTATGACCACTCCTCCAACTTCTCCTGGAAATGTCCCACCTGATCTGTCACACCCTTACA
GT
AAAGTCTTTGGTACAACTGCAGGTGGAAAAGGAACTCCTCTGGGAACCCCAGCAACCTCTCCTCCTCC
A
GCCCCACTCTGTCATTCGGATGACTACGTGCACATTTCACTCCCCCAGGCCACAGTCACACCCCCCAGG
AAG
GAAGAGAGAATGGATTCTGCAAGACCATGTCTACACAGACAACACCATCTTCTGAATGACAGAGGAT
CA
GAAGAGCCACCTGGCAGCAAAGGTTCTGTCACTCTAAGTGATCTTCCAGGGTTTTTAGGTGATCTGGC
C
TCTGAAGAAGATAGTATTGAAAAAGATAAAGAAGAAGCTGCAATATCTAGAGAACTTTCTGAGATCACC
ACA
GCAGAGGCAGAGCCTGTGGTTCCTCGAGGAGGCTTTGACTCTCCCTTTTACCGAGACAGTCTCCCAG
GT
TCTCAGCGGAAGACCCACTCGGCAGCCTCCAGTTCTCAGGGCGCCAGCGTGAACCCTGAGCCTTTACA
C
TCCTCCCTGGACAAGCTTGGGCCTGACACACCAAAGCAAGCCTTTACTCCCATAGACCTGCCCTGCGGC
AGT
GCTGATGAAAGCCCTGCGGGAGACAGGGAATGCCAGACTTCTTTGGAGACCAGTATCTTCACTCCCA
GT
CCTTGTAAAATTCCACCTCCGACGAGAGTGGGCTTTGGAAGCGGGCAGCCTCCCCCGTATGATCATCT
T
TTTGAGGTGGCATTGCCAAAGACAGCCCATCATTTTGTCATCAGGAAGACTGAGGAGCTGTTAAAGAAA
GCA
AAAGGAAACACAGAGGAAGATGGTGTGCCCTCTACCTCCCCAATGGAAGTGCTGGACAGACTGATAC
AG
CAGGGAGCAGACGCGCACAGCAAGGAGCTGAACAAGTTGCCTTTACCCAGCAAGTCTGTCGACTGGAC
C
CACTTTGGAGGCTCTCCTCCTTCAGATGAGATCCGCACCCTCCGAGACCAGTTGCTTTTACTGCACAAC
CAG
TTACTCTATGAGCGTTTTAAGAGGCAGCAGCATGCCCTCCGGAACAGGCGGCTCCTCCGCAAGGTGA
TC
AAAGCAGCAGCTCTGGAGGAACATAATGCTGCCATGAAAGATCAGTTGAAGTTACAAGAGAAGGACAT
C
CAGATGTGGAAGGTTAGTCTGCAGAAAGAACAAGCTAGATACAATCAGCTCCAGGAGCAGCGTGACACT
ATG
GTAACCAAGCTCCACAGCCAGATCAGACAGCTGCAGCATGACCGAGAGGAATTCTACAACCAGAGCC
AG
GAATTACAGACGAAGCTGGAGGACTGCAGGAACATGATTGCGGAGCTGCGGATAGAACTGAAGAAGGC
C
AACAACAAGGTGTGTCACACTGAGCTGCTGCTCAGTCAGGTTTCCCAAAAGCTCTCAAACAGTGAGTCG
GTC
CAGCAGCAGATGGAGTTCTTGAACAGGCAGCTGTTGGTTCTTGGGGAGGTCAACGAGCTCTATTTGG
AA
CAACTGCAGAACAAGCACTCAGATACCACAAAGGAAGTAGAAATGATGAAAGCCGCCTATCGGAAAGA
G
CTAGAAAAAAACAGAAGCCATGTTCTCCAGCAGACTCAGAGGCTTGATACCTCCCAAAAACGGATTTTG
GAA
CTGGAATCTCACCTGGCCAAGAAAGACCACCTTCTTTTGGAACAGAAGAAATATCTAGAGGATGTCA
AA
CTCCAGGCAAGAGGACAGCTGCAGGCCGCAGAGAGCAGGTATGAGGCTCAGAAAAGGATAACCCAGGT
G
TTTGAATTGGAGATCTTAGATTTATATGGCAGGTTGGAGAAAGATGGCCTCCTGAAAAAACTTGAAGAA
GAA
AAAGCAGAAGCAGCTGAAGCAGCAGAAGAAAGGCTTGACTGTTGTAATGACGGGTGCTCAGATTCCA
TG
GTAGGGCACAATGAAGAGGCATCTGGCCACAACGGTGAGACCAAGACCCCCAGGCCCAGCAGCGCCCG
G
GGCAGTAGTGGAAGCAGAGGTGGTGGAGGCAGCAGCAGCAGCAGCAGCGAGCTTTCTACCCCAGAGAAA
CCC
CCACACCAGAGGGCAGGCCCATTCAGCAGTCGGTGGGAGACGACTATGGGAGAAGCGTCTGCCAGCA
TC
CCCACCACTGTGGGCTCACTTCCCAGTTCAAAAAGCTTCCTGGGTATGAAGGCTCGAGAGTTATTTCG
T
AATAAGAGCGAGAGCCAGTGTGATGAGGACGGCATGACCAGTAGCCTTTCTGAGAGCCTAAAGACAGAA
CTG
GGCAAAGACTTGGGTGTGGAAGCCAAGATTCCCCTGAACCTAGATGGCCCTCACCCGTCTCCCCCGA
CC
CCGGACAGTGTTGGACAGCTACATATCATGGACTACAATGAGACTCATCATGAACACAGCTAA


Translation (1164 aa):
MAQQANVGELLAMLDSPMLGVRDDVTAVFKENLNSDRGPMLVNTLVDYYLETSSQPALHILTTLQEPHDK
H
LLDRINEYVGKAATRLSILSLLGHVIRLQPSWKHKLSQAPLLPSLLKCLK
MDTDVVVLTTGVLVLITML
P
MIPQSGKQHLLDFFDIFGRLSSWCLKKP
GHVAEVYLVHLHASVYALFHRLYGMYPCNFVSFLRSHYSMK
E
NLETFEEVVK
PMMEHVRIHPELVTGSKDHELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQ
I
SARFPHRSADVTTSPYADTQNSY
GCATSTPYSTSRLMLLNMPGQLPQTLSSPSTRLITEPPQATLWSPS
M
VCGMTTPPTSPGNVPPDLSHPYSKVFGTT
AGGKGTPLGTPATSPPPAPLCHSDDYVHISLPQATVTPPR
K
EERMDSARPCLHRQHHLLNDRGSEEPPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAISRELSEIT
T
AEAEPVVPRGGFDSPFYRDSLPGSQRKTHSAASSSQGASVNPEPLHSSLDKLGPDTPKQAFTPIDLPCG
S
ADESPAGDRECQTSLETSIFTPSPCKIPPPTRVGFGSGQPPPYDHLFEVALPKTAHHFVIRKTEELLKK
A
KGNTEEDGVPSTSPMEVLDRLIQQGADAHSKELN
KLPLPSKSVDWTHFGGSPPSDEIRTLRDQLLLLHN
Q
LLYERFKRQQHALRNRRLLRKVIKAAALEEHNAAM
KDQLKLQEKDIQMWKVSLQKEQARYNQLQEQRDT
M
VTKLHSQIRQLQHDREEFYNQSQELQ
TKLEDCRNMIAELRIELKKANNKVCHTELLLSQVSQKLSNSES
V
QQQMEFLNRQLLVLGEVNELYLEQLQNKHSDTTK
EVEMMKAAYRKELEKNRSHVLQQTQRLDTSQKRIL
E
LESHLAKKDHLLLEQKKYLEDVKLQA
RGQLQAAESRYEAQKRITQVFELEILDLYGRLEKDGLLKKLEE
E
KAEAAEAAEE
RLDCCNDGCSDSMVGHNEEASGHNGETKTPRPSSARGSSGSRGGGGSSSSSSELSTPEK
P
PHQRAGPFSSRWETTMGEASASIPTTVGSLPSSKSFLGMKARELFRNKSESQCDEDGMTSSLSESLKTE
L
GKDLGVEAKIPLNLDGPHPSPPTPDSVGQLHIMDYNETHHEHS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser