NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6907.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6907.1 Public Homo sapiens 9 SET 22 109 92 CCDS HistoryNCBI Gene:6418Re-query CCDS DB by CCDS ID:6907.1Re-query CCDS DB by GeneID:6418See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6907.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000322030.12 ENSP00000318012.8 Accepted alive Link to Ensembl Transcript Viewer:ENST00000322030.12Link to Ensembl Protein Viewer:ENSP00000318012.8Re-query CCDS DB by Nucleotide ID:ENST00000322030Re-query CCDS DB by Protein ID:ENSP00000318012
Original member NCBI NM_003011.3 NP_003002.2 Updated not alive Link to Nucleotide Sequence:NM_003011.3Link to Protein Sequence:NP_003002.2Re-query CCDS DB by Nucleotide ID:NM_003011Re-query CCDS DB by Protein ID:NP_003002
Current member NCBI NM_003011.4 NP_003002.2 Accepted alive Link to Nucleotide Sequence:NM_003011.4Link to Protein Sequence:NP_003002.2Re-query CCDS DB by Nucleotide ID:NM_003011Re-query CCDS DB by Protein ID:NP_003002Link to BLAST:NP_003002.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_003002.2 277 Q01105-2 277 100% 0 0

Chromosomal Locations for CCDS 6907.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 128689583 128689655 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 128691170 128691227 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 128691858 128692000 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 128692662 128692765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 128692868 128692981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 128693638 128693808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 128693896 128694042 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 128694641 128694664 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (834 nt):
ATGTCGGCGCCGGCGGCCAAAGTCAGTAAAAAGGAGCTCAACTCCAACCACGACGGGGCCGACGAGACCT
CA
GAAAAAGAACAGCAAGAAGCGATTGAACACATTGATGAAGTACAAAATGAAATAGACAGACTTAATGA
A
CAAGCCAGTGAGGAGATTTTGAAAGTAGAACAGAAATATAACAAACTCCGCCAACCATTTTTTCAGAAG
AGG
TCAGAATTGATCGCCAAAATCCCAAATTTTTGGGTAACAACATTTGTCAACCATCCACAAGTGTCTG
CA
CTGCTTGGGGAGGAAGATGAAGAGGCACTGCATTATTTGACCAGAGTTGAAGTGACAGAATTTGAAGA
T
ATTAAATCAGGTTACAGAATAGATTTTTATTTTGATGAAAATCCTTACTTTGAAAATAAAGTTCTCTCC
AAA
GAATTTCATCTGAATGAGAGTGGTGATCCATCTTCGAAGTCCACCGAAATCAAATGGAAATCTGGAA
AG
GATTTGACGAAACGTTCGAGTCAAACGCAGAATAAAGCCAGCAGGAAGAGGCAGCATGAGGAACCAGA
G
AGCTTCTTTACCTGGTTTACTGACCATTCTGATGCAGGTGCTGATGAGTTAGGAGAGGTCATCAAAGAT
GAT
ATTTGGCCAAACCCATTACAGTACTACTTGGTTCCCGATATGGATGATGAAGAAGGAGAAGGAGAAG
AA
GATGATGATGATGATGAAGAGGAGGAAGGATTAGAAGATATTGACGAAGAAGGGGATGAGGATGAAGG
T
GAAGAAGATGAAGATGATGATGAAGGGGAGGAAGGAGAGGAGGATGAAGGAGAAGATGACTAA


Translation (277 aa):
MSAPAAKVSKKELNSNHDGADETSEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQK
R
SELIAKIPNFWVTTFVNHPQ
VSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLS
K
EFHLNESGDPSSKSTEIKWKSGK
DLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKD
D
IWPNPLQYYL
VPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser