NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6728.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6728.1 Public Homo sapiens 9 NCBP1 22 109 92 CCDS HistoryNCBI Gene:4686Re-query CCDS DB by CCDS ID:6728.1Re-query CCDS DB by GeneID:4686See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6728.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000375147.7 ENSP00000364289.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000375147.7Link to Ensembl Protein Viewer:ENSP00000364289.3Re-query CCDS DB by Nucleotide ID:ENST00000375147Re-query CCDS DB by Protein ID:ENSP00000364289
Original member NCBI NM_002486.4 NP_002477.1 Updated not alive Link to Nucleotide Sequence:NM_002486.4Link to Protein Sequence:NP_002477.1Re-query CCDS DB by Nucleotide ID:NM_002486Re-query CCDS DB by Protein ID:NP_002477
Current member NCBI NM_002486.5 NP_002477.1 Accepted alive Link to Nucleotide Sequence:NM_002486.5Link to Protein Sequence:NP_002477.1Re-query CCDS DB by Nucleotide ID:NM_002486Re-query CCDS DB by Protein ID:NP_002477Link to BLAST:NP_002477.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002477.1 790 Q09161 790 100% 0 0

Chromosomal Locations for CCDS 6728.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 97633882 97633915 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97640794 97640882 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97641562 97641662 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97643204 97643360 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97645117 97645224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97645611 97645732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97647492 97647561 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97648008 97648223 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97650503 97650600 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97651310 97651373 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97653798 97653908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97654880 97654944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97655702 97655764 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97656011 97656085 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97658640 97658743 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97660946 97661068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97662042 97662144 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97662954 97663047 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97664340 97664443 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97666763 97666877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97668846 97668974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97669593 97669706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 97671086 97671199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2373 nt):
ATGTCGCGGCGGCGGCACAGCGACGAGAACGACGGTGGGCAGCCTCACAAAAGGAGAAAGACCTCTGATG
CA
AATGAAACTGAAGATCATTTGGAATCTTTAATATGTAAAGTAGGAGAAAAGAGTGCCTGCTCTTTGGA
G
AGCAACCTAGAAGGCTTGGCTGGTGTTTTGGAAGCTGATCTTCCTAACTACAAGAGCAAGATCTTAAGG
CTT
CTTTGTACAGTTGCACGCCTATTACCTGAGAAGCTGACAATTTATACAACATTAGTTGGACTACTGA
AT
GCCAGGAATTACAATTTTGGTGGAGAATTTGTAGAAGCCATGATTCGTCAACTTAAAGAATCATTGAA
A
GCAAACAATTATAATGAAGCCGTGTATTTGGTCCGTTTTTTATCTGATCTTGTGAATTGTCATGTGATT
GCC
GCCCCATCAATGGTTGCTATGTTTGAAAATTTTGTAAGCGTAACTCAGGAAGAAGATGTACCTCAGG
TG
CGACGAGATTGGTATGTGTATGCATTTCTGTCATCTTTGCCCTGGGTTGGAAAGGAGTTGTACGAAAA
G
AAAGATGCAGAGATGGACCGCATCTTTGCCAACACTGAAAGCTATCTTAAAAGACGCCAAAAGACTCAT
GTA
CCCATGTTACAGGTATGGACTGCTGATAAACCACATCCACAAGAAGAGTATTTAGATTGCCTGTGGG
CC
CAGATTCAGAAATTGAAAAAGGATCGCTGGCAGGAACGGCACATCCTAAGACCTTATCTTGCCTTTGA
C
AGCATCCTGTGTGAAGCACTGCAGCACAATCTGCCTCCTTTTACACCACCTCCTCACACTGAAGATTCA
GTG
TACCCAATGCCAAGGGTCATCTTCAGAATGTTTGATTACACAGATGATCCCGAGGGTCCTGTCATGC
CA
GGGAGTCATTCAGTGGAAAGATTTGTAATAGAAGAGAATCTTCACTGCATCATTAAGTCCCACTGGAA
G
GAAAGGAAGACTTGTGCTGCACAGTTAGTGAGCTATCCAGGGAAGAACAAGATCCCCTTGAACTACCAC
ATA
GTTGAGGTGATCTTTGCAGAGCTGTTTCAACTTCCAGCACCCCCTCACATTGATGTGATGTACACAA
CA
CTCCTCATTGAACTGTGCAAACTTCAACCTGGCTCTCTACCCCAAGTTCTTGCACAGGCAACTGAAAT
G
CTATACATGCGTTTGGACACAATGAACACTACCTGTGTAGACAGGTTTATTAATTGGTTTTCTCATCAT
CTA
AGTAACTTCCAGTTCCGTTGGAGCTGGGAAGATTGGTCAGATTGTCTTAGTCAAGATCCTGAAAGTC
CC
AAACCGAAGTTTGTAAGAGAAGTTCTAGAAAAATGTATGAGGTTGTCTTACCATCAGCGTATATTAGA
T
ATTGTTCCTCCTACCTTCTCAGCTCTGTGTCCTGCAAACCCAACCTGCATTTACAAGTATGGAGATGAA
AGT
AGCAATTCTCTTCCTGGACATTCTGTTGCCCTCTGTTTAGCTGTTGCCTTTAAAAGTAAGGCAACCA
AT
GATGAAATCTTCAGCATTCTGAAAGATGTACCAAATCCTAACCAGGATGATGACGACGATGAAGGATT
C
AGTTTTAACCCATTGAAAATAGAAGTCTTTGTACAGACTCTGCTACACTTGGCAGCCAAATCATTCAGC
CAC
TCCTTCAGTGCTCTTGCAAAGTTTCATGAAGTCTTCAAAACCCTAGCTGAAAGTGATGAAGGAAAGT
TA
CATGTGCTAAGAGTTATGTTTGAGGTCTGGAGGAACCATCCACAGATGATTGCTGTACTAGTGGATAA
G
ATGATTCGTACACAAATAGTTGATTGTGCTGCCGTAGCAAATTGGATCTTCTCTTCAGAACTATCTCGT
GAC
TTTACCAGATTGTTTGTTTGGGAAATTTTGCACTCTACAATTCGTAAGATGAACAAACATGTCCTGA
AG
ATCCAGAAAGAGCTGGAAGAAGCTAAAGAGAAACTTGCTAGGCAACACAAACGGCGAAGTGATGATGA
C
GACAGAAGCAGTGACAGGAAAGACGGGGTTCTTGAGGAACAAATAGAACGACTTCAGGAAAAAGTGGAA
TCT
GCTCAGAGTGAACAAAAGAATCTTTTCCTCGTTATATTTCAGCGGTTTATCATGATCTTGACCGAGC
AC
CTAGTACGATGCGAAACTGATGGGACCAGTGTATTAACACCATGGTATAAGAACTGTATAGAGAGGCT
G
CAGCAGATCTTCCTACAGCATCACCAAATAATCCAGCAGTACATGGTGACCCTGGAGAACCTTCTCTTC
ACT
GCTGAATTAGACCCTCATATCTTGGCCGTGTTCCAGCAGTTCTGTGCCCTGCAGGCCTAA


Translation (790 aa):
MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILR
L
LCT
VARLLPEKLTIYTTLVGLLNARNYNFGGEFVEAMIRQLKESLKANNYNEAVYLVRFLSDLVNCHVI
A
APSMVAMFENFVSVTQEEDVPQ
VRRDWYVYAFLSSLPWVGKELYEKKDAEMDRIFANTESYLKRRQKTH
V
PMLQVWTADKPHPQEE
YLDCLWAQIQKLKKDRWQERHILRPYLAFDSILCEALQHNLPPFTPPPHTEDS
V
YPMPRVIFRMFDYTDDPE
GPVMPGSHSVERFVIEENLHCIIKSHWKERKTCAAQLVSYPGKNKIPLNYH
I
VE
VIFAELFQLPAPPHIDVMYTTLLIELCKLQPGSLPQVLAQATEMLYMRLDTMNTTCVDRFINWFSHH
L
SNFQFRWSWED
WSDCLSQDPESPKPKFVREVLEKCMRLSYHQRILDIVPPTFSALCPANPTCIYKYGDE
S
S
NSLPGHSVALCLAVAFKSKATNDEIFSILKDVPNPNQDDDDDEGFSFNPLKIEVFVQTLLHLAAKSFS
H
SFSALA
KFHEVFKTLAESDEGKLHVLRVMFEVWRNHPQMIAVLVDKMIRTQIVDCAAVANWIFSSELSR
D
FT
RLFVWEILHSTIRKMNKHVLKIQKELEEAKEKLARQHKRRSDDDDRSSDRKDGVLEEQIERLQEKVE
S
AQSEQKNLFLVIFQ
RFIMILTEHLVRCETDGTSVLTPWYKNCIERLQQIFLQHHQIIQQYMVTLENLLF
T
AELDPHILAVFQQFCALQA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser