NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS67099.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
67099.1 Public Homo sapiens 16 FANCA 22 109 92 CCDS HistoryNCBI Gene:2175Re-query CCDS DB by CCDS ID:67099.1Re-query CCDS DB by GeneID:2175See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 15, NCBI annotation release 105, Ensembl annotation release 74

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 67099.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000568369.5 ENSP00000456829.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000568369.5Link to Ensembl Protein Viewer:ENSP00000456829.1Re-query CCDS DB by Nucleotide ID:ENST00000568369Re-query CCDS DB by Protein ID:ENSP00000456829
Original member NCBI NM_001286167.2 NP_001273096.1 Updated not alive Link to Nucleotide Sequence:NM_001286167.2Link to Protein Sequence:NP_001273096.1Re-query CCDS DB by Nucleotide ID:NM_001286167Re-query CCDS DB by Protein ID:NP_001273096
Current member NCBI NM_001286167.3 NP_001273096.1 Accepted alive Link to Nucleotide Sequence:NM_001286167.3Link to Protein Sequence:NP_001273096.1Re-query CCDS DB by Nucleotide ID:NM_001286167Re-query CCDS DB by Protein ID:NP_001273096Link to BLAST:NP_001273096.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001273096.1 1424 O15360-3 1424 100% 0 0

Chromosomal Locations for CCDS 67099.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 89738698 89738708 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89738882 89738974 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89739129 89739289 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89739478 89739553 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89739994 89740099 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89740804 89740866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89742800 89742938 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89744959 89745071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89746584 89746688 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89746831 89746890 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89748659 89748767 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89749730 89749902 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89752138 89752222 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89758577 89758705 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89761949 89762022 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89764890 89765066 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89767141 89767237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89769837 89770024 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89770166 89770259 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89770564 89770634 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89771678 89771814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89773271 89773384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89775742 89775815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89778801 89778850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89778943 89779003 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89779869 89779957 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89782859 89782918 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89783007 89783102 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89784854 89784964 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89791403 89791536 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89791927 89792068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89792471 89792547 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89795906 89796018 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89799166 89799232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89799605 89799638 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89803259 89803341 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89805280 89805392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89808294 89808367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89810707 89810802 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89810929 89811071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89814520 89814613 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89815877 89815986 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 89816537 89816615 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4275 nt):
ATGTCCGACTCGTGGGTCCCGAACTCCGCCTCGGGCCAGGACCCAGGGGGCCGCCGGAGGGCCTGGGCCG
AG
CTGCTGGCGGGAAGGGTCAAGAGGGAAAAATATAATCCTGAAAGGGCACAGAAATTAAAGGAATCAGC
T
GTGCGCCTCCTGCGAAGCCATCAGGACCTGAATGCCCTTTTGCTTGAGGTAGAAGGTCCACTGTGTAAA
AAA
TTGTCTCTCAGCAAAGTGATTGACTGTGACAGTTCTGAGGCCTATGCTAATCATTCTAGTTCATTTA
TA
GGCTCTGCTTTGCAGGATCAAGCCTCAAGGCTGGGGGTTCCCGTGGGTATTCTCTCAGCCGGGATGGT
T
GCCTCTAGCGTGGGACAGATCTGCACGGCTCCAGCGGAGACCAGTCACCCTGTGCTGCTGACTGTGGAG
CAG
AGAAAGAAGCTGTCTTCCCTGTTAGAGTTTGCTCAGTATTTATTGGCACACAGTATGTTCTCCCGTC
TT
TCCTTCTGTCAAGAATTATGGAAAATACAGAGTTCTTTGTTGCTTGAAGCGGTGTGGCATCTTCACGT
A
CAAGGCATTGTGAGCCTGCAAGAGCTGCTGGAAAGCCATCCCGACATGCATGCTGTGGGATCGTGGCTC
TTC
AGGAATCTGTGCTGCCTTTGTGAACAGATGGAAGCATCCTGCCAGCATGCTGACGTCGCCAGGGCCA
TG
CTTTCTGATTTTGTTCAAATGTTTGTTTTGAGGGGATTTCAGAAAAACTCAGATCTGAGAAGAACTGT
G
GAGCCTGAAAAAATGCCGCAGGTCACGGTTGATGTACTGCAGAGAATGCTGATTTTTGCACTTGACGCT
TTG
GCTGCTGGAGTACAGGAGGAGTCCTCCACTCACAAGATCGTGAGGTGCTGGTTCGGAGTGTTCAGTG
GA
CACACGCTTGGCAGTGTAATTTCCACAGATCCTCTGAAGAGGTTCTTCAGTCATACCCTGACTCAGAT
A
CTCACTCACAGCCCTGTGCTGAAAGCATCTGATGCTGTTCAGATGCAGAGAGAGTGGAGCTTTGCGCGG
ACA
CACCCTCTGCTCACCTCACTGTACCGCAGGCTCTTTGTGATGCTGAGTGCAGAGGAGTTGGTTGGCC
AT
TTGCAAGAAGTTCTGGAAACGCAGGAGGTTCACTGGCAGAGAGTGCTCTCCTTTGTGTCTGCCCTGGT
T
GTCTGCTTTCCAGAAGCGCAGCAGCTGCTTGAAGACTGGGTGGCGCGTTTGATGGCCCAGGCATTCGAG
AGC
TGCCAGCTGGACAGCATGGTCACTGCGTTCCTGGTTGTGCGCCAGGCAGCACTGGAGGGCCCCTCTG
CG
TTCCTGTCATATGCAGACTGGTTCAAGGCCTCCTTTGGGAGCACACGAGGCTACCATGGCTGCAGCAA
G
AAGGCCCTGGTCTTCCTGTTTACGTTCTTGTCAGAACTCGTGCCTTTTGAGTCTCCCCGGTACCTGCAG
GTG
CACATTCTCCACCCACCCCTGGTTCCCGGCAAGTACCGCTCCCTCCTCACAGACTACATCTCATTGG
CC
AAGACACGGCTGGCCGACCTCAAGGTTTCTATAGAAAACATGGGACTCTACGAGGATTTGTCATCAGC
T
GGGGACATTACTGAGCCCCACAGCCAAGCTCTTCAGGATGTTGAAAAGGCCATCATGGTGTTTGAGCAT
ACG
GGGAACATCCCAGTCACCGTCATGGAGGCCAGCATATTCAGGAGGCCTTACTACGTGTCCCACTTCC
TC
CCCGCCCTGCTCACACCTCGAGTGCTCCCCAAAGTCCCTGACTCCCGTGTGGCGTTTATAGAGTCTCT
G
AAGAGAGCAGATAAAATCCCCCCATCTCTGTACTCCACCTACTGCCAGGCCTGCTCTGCTGCTGAAGAG
AAG
CCAGAAGATGCAGCCCTGGGAGTGAGGGCAGAACCCAACTCTGCTGAGGAGCCCCTGGGACAGCTCA
CA
GCTGCACTGGGAGAGCTGAGAGCCTCCATGACAGACCCCAGCCAGCGTGATGTTATATCGGCACAGGT
G
GCAGTGATTTCTGAAAGACTGAGGGCTGTCCTGGGCCACAATGAGGATGACAGCAGCGTTGAGATATCA
AAG
ATTCAGCTCAGCATCAACACGCCGAGACTGGAGCCACGGGAACACATGGCTGTGGACCTCCTGCTGA
CG
TCTTTCTGTCAGAACCTGATGGCTGCCTCCAGTGTCGCTCCCCCGGAGAGGCAGGGTCCCTGGGCTGC
C
CTCTTCGTGAGGACCATGTGTGGACGTGTGCTCCCTGCAGTGCTCACCCGGCTCTGCCAGCTGCTCCGT
CAC
CAGGGCCCGAGCCTGAGTGCCCCACATGTGCTGGGGTTGGCTGCCCTGGCCGTGCACCTGGGTGAGT
CC
AGGTCTGCGCTCCCAGAGGTGGATGTGGGTCCTCCTGCACCTGGTGCTGGCCTTCCTGTCCCTGCGCT
C
TTTGACAGCCTCCTGACCTGTAGGACGAGGGATTCCTTGTTCTTCTGCCTGAAATTTTGTACAGCAGCA
ATT
TCTTACTCTCTCTGCAAGTTTTCTTCCCAGTCACGAGATACTTTGTGCAGCTGCTTATCTCCAGGCC
TT
ATTAAAAAGTTTCAGTTCCTCATGTTCAGATTGTTCTCAGAGGCCCGACAGCCTCTTTCTGAGGAGGA
C
GTAGCCAGCCTTTCCTGGAGACCCTTGCACCTTCCTTCTGCAGACTGGCAGAGAGCTGCCCTCTCTCTC
TGG
ACACACAGAACCTTCCGAGAGGTGTTGAAAGAGGAAGATGTTCACTTAACTTACCAAGACTGGTTAC
AC
CTGGAGCTGGAAATTCAACCTGAAGCTGATGCTCTTTCAGATACTGAACGGCAGGACTTCCACCAGTG
G
GCGATCCATGAGCACTTTCTCCCTGAGTCCTCGGCTTCAGGGGGCTGTGACGGAGACCTGCAGGCTGCG
TGT
ACCATTCTTGTCAACGCACTGATGGATTTCCACCAAAGCTCAAGGAGTTATGACCACTCAGAAAATT
CT
GATTTGGTCTTTGGTGGCCGCACAGGAAATGAGGATATTATTTCCAGATTGCAGGAGATGGTAGCTGA
C
CTGGAGCTGCAGCAAGACCTCATAGTGCCTCTCGGCCACACCCCTTCCCAGGAGCACTTCCTCTTTGAG
ATT
TTCCGCAGACGGCTCCAGGCTCTGACAAGCGGGTGGAGCGTGGCTGCCAGCCTTCAGAGACAGAGGG
AG
CTGCTAATGTACAAACGGATCCTCCTCCGCCTGCCTTCGTCTGTCCTCTGCGGCAGCAGCTTCCAGGC
A
GAACAGCCCATCACTGCCAGATGCGAGCAGTTCTTCCACTTGGTCAACTCTGAGATGAGAAACTTCTGC
TCC
CACGGAGGTGCCCTGACACAGGACATCACTGCCCACTTCTTCAGGGGCCTCCTGAACGCCTGTCTGC
GG
AGCAGAGACCCCTCCCTGATGGTCGACTTCATACTGGCCAAGTGCCAGACGAAATGCCCCTTAATTTT
G
ACCTCTGCTCTGGTGTGGTGGCCGAGCCTGGAGCCTGTGCTGCTCTGCCGGTGGAGGAGACACTGCCAG
AGC
CCGCTGCCCCGGGAACTGCAGAAGCTACAAGAAGGCCGGCAGTTTGCCAGCGATTTCCTCTCCCCTG
AG
GCTGCCTCCCCAGCACCCAACCCGGACTGGCTCTCAGCTGCTGCACTGCACTTTGCGATTCAACAAGT
C
AGGGAAGAAAACATCAGGAAGCAGCTAAAGAAGCTGGACTGCGAGAGAGAGGAGCTATTGGTTTTCCTT
TTC
TTCTTCTCCTTGATGGGCCTGCTGTCGTCACATCTGACCTCAAATAGCACCACAGACCTGCCAAAGG
CT
TTCCACGTTTGTGCAGCAATCCTCGAGTGTTTAGAGAAGAGGAAGATATCCTGGCTGGCACTCTTTCA
G
TTGACAGAGAGTGACCTCAGGCTGGGGCGGCTCCTCCTCCGTGTGGCCCCGGATCAGCACACCAGGCTG
CTG
CCTTTCGCTTTTTACAGTCTTCTCTCCTACTTCCATGAAGACGCGGCCATCAGGGAAGAGGCCTTCC
TG
CATGTTGCTGTGGACATGTACTTGAAGCTGGTCCAGCTCTTCGTGGCTGGGGATACAAGCACAGTTTC
A
CCTCCAGCTGGCAGGAGCCTGGAGCTCAAGGGTCAGGCAGGGCAACCCCGTGGAACTGATAACAAAAGC
TCG
TCTTTTTCTGCTGCAGTTAATACCTCGGTGCCCGAAAAAGAGCTTCTCACACGTGGCAGAGCTGCTG
GC
TGA


Translation (1424 aa):
MSDSWVPNSASGQDPGGRRRAWAELLAGRVKREKYNPERAQKLKESAVRLLRSHQDLNALLLEVEGPLCK
K
LSLSKVIDCDSSEAYANHSSSFI
GSALQDQASRLGVPVGILSAGMVASSVGQICTAPAETSHPVLLTVE
Q
R
KKLSSLLEFAQYLLAHSMFSRLSFCQELWKIQSSLLLEAVWHLHVQGIVSLQELLESHPDMHAVGSWL
F
RNLCCLCEQMEASCQHADVARAMLS
DFVQMFVLRGFQKNSDLRRTVEPEKMPQVTVDVLQRMLIFALDA
L
AAGVQEESSTHKIVRC
WFGVFSGHTLGSVISTDPLKRFFSHTLTQILTHSPVLKASDAVQMQREWSFAR
T
HPLLTSLYRR
LFVMLSAEELVGHLQEVLETQEVHWQRVLSFVSALVVCFPEAQQLLEDWVARLMAQAFE
S
CQLDSMVTAFLVVRQAALEGPSAFLSYADWFK
ASFGSTRGYHGCSKKALVFLFTFLSELVPFESPRYLQ
V
HILHPPLVPGKYRSLLTDYISLAKTRLADLK
VSIENMGLYEDLSSAGDITEPHSQALQDVEKAIMVFEH
T
GNIPVTVMEA
SIFRRPYYVSHFLPALLTPRVLPKVPDSRVAFIESLKRADKIPPSLYSTYCQACSAAEE
K
PE
DAALGVRAEPNSAEEPLGQLTAALGELRASMTDPSQRDVISAQVAVISERLRAVLGHNEDDSSVEIS
K
IQLSINTPRLEPREHM
AVDLLLTSFCQNLMAASSVAPPERQGPWAALFVRTMCGRVLPAVLTRLCQLLR
H
Q
GPSLSAPHVLGLAALAVHLGESRSALPEVDVGPPAPGAGLPVPALFDSLLTCRTRDSLFFCLKFCTAA
I
SYSLCKFSSQSRDTLCSCLSPGLIKK
FQFLMFRLFSEARQPLSEEDVASLSWRPLHLPSADWQRAALSL
W
THRTFREVLKEEDVH
LTYQDWLHLELEIQPEADALSDTERQDFHQWAIHEHFLPESSASGGCDGDLQAA
C
TILVNALMDFHQ
SSRSYDHSENSDLVFGGRTGNEDIISRLQEMVADLELQQDLIVPLGHTPSQEHFLFE
I
FRRRLQALTSGWSVAASLQRQRELLMYK
RILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFC
S
HGGALTQDITAHFFR
GLLNACLRSRDPSLMVDFILAKCQTKCPLILTSALVWWPSLEPVLLCRWRRHCQ
S
PLPRELQKLQEGRQFAS
DFLSPEAASPAPNPDWLSAAALHFAIQQVREENIRKQLKKLDCEREELLVFL
F
FFSLMGLLSSHLTSN
STTDLPKAFHVCAAILECLEKRKISWLALFQLTESDLRLGRLLLRVAPDQHTRL
L
PFAFY
SLLSYFHEDAAIREEAFLHVAVDMYLKLVQLFVAGDTSTVSPPAGRSLELKGQAGQPRGTDNKS
S
SFSAAVNTSVPEKELLTRGR
AAG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser