NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS67088.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
67088.1 Public Homo sapiens 16 ATP2C2 22 109 92 CCDS HistoryNCBI Gene:9914Re-query CCDS DB by CCDS ID:67088.1Re-query CCDS DB by GeneID:9914See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 15, NCBI annotation release 105, Ensembl annotation release 74

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 67088.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000416219.6 ENSP00000397925.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000416219.6Link to Ensembl Protein Viewer:ENSP00000397925.2Re-query CCDS DB by Nucleotide ID:ENST00000416219Re-query CCDS DB by Protein ID:ENSP00000397925
Original member Current member NCBI NM_001286527.2 NP_001273456.2 Accepted alive Link to Nucleotide Sequence:NM_001286527.2Link to Protein Sequence:NP_001273456.2Re-query CCDS DB by Nucleotide ID:NM_001286527Re-query CCDS DB by Protein ID:NP_001273456Link to BLAST:NP_001273456.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001273456.2 975 O75185-3 975 100% 0 0

Chromosomal Locations for CCDS 67088.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 84368616 84368714 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84398499 84398609 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84405128 84405244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84408405 84408494 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84410568 84410603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84410704 84410765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84415483 84415591 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84422390 84422539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84422629 84422697 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84423188 84423263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84425735 84425801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84439166 84439290 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84439427 84439524 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84440857 84440958 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84442510 84442599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84446329 84446430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84448533 84448689 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84451921 84452091 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84453138 84453235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84453321 84453371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84454818 84454984 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84459120 84459188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84459270 84459386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84459506 84459592 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84460654 84460801 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84461714 84461812 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84461988 84462129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 84463614 84463732 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2928 nt):
ATGGTCGAGGGACGCGTCTCCGAGTTCCTGAAGAAACTCGGCTTCTCGGGCGGGGGCCGCCAGTACCAGG
CG
CTGGAGAAGGACGAAGAGGAAGCCTTGATTGATGAACAGAGTGAGCTGAAAGCCATCGAGAAAGAGAA
G
AAGGTGACAGCCCTGCCCCCCAAGGAAGCGTGCAAATGCCAGAAAGAGGATTTGGCCAGAGCGTTTTGT
GTG
GACTTACACACTGGGCTGTCGGAGTTCTCGGTGACGCAGCGCCGGCTGGCCCATGGCTGGAATGAGT
TT
GTTGCTGACAACAGCGAACCTGTGTGGAAGAAATACCTGGATCAGTTTAAGAACCCCCTGATCCTGCT
G
CTGCTGGGCTCTGCCCTGGTGAGTGTCCTCACCAAGGAGTATGAGGACGCCGTCAGCATCGCCACGGCA
GTG
CTTGTCGTGGTCACTGTCGCCTTCATCCAGGAGTACAGGTCGGAGAAATCTCTGGAAGAGCTGACCA
AG
CTGGTTCCTCCAGAATGTAACTGCCTAAGAGAAGGAAAACTCCAGCACCTGCTTGCTCGAGAACTGGT
T
CCTGGTGATGTCGTATCTCTCTCGATCGGAGACCGGATCCCTGCAGACATCCGACTCACTGAGGTCACG
GAC
CTCTTGGTGGATGAATCCAGTTTCACCGGGGAAGCCGAGCCATGTAGTAAAACAGACAGCCCCTTGA
CA
GGCGGTGGGGACCTCACCACCCTCAGCAACATCGTCTTCATGGGGACCCTGGTGCAGTATGGGAGGGG
C
CAGGGGGTCGTGATTGGAACAGGGGAAAGCTCTCAGTTCGGAGAAGTGTTTAAGATGATGCAGGCTGAA
GAG
ACACCTAAAACTCCTTTGCAGAAAAGCATGGACAGGCTAGGAAAGCAACTGACACTCTTCTCCTTTG
GC
ATAATCGGTCTCATCATGCTCATTGGCTGGTCGCAAGGGAAACAACTCCTGAGTATGTTCACGATCGG
G
GTCAGCCTGGCTGTGGCGGCCATTCCAGAGGGTCTGCCCATCGTCGTCATGGTGACGCTGGTCCTGGGA
GTG
CTGCGGATGGCCAAGAAGCGGGTCATCGTGAAGAAGTTACCCATCGTGGAGACTTTAGGTTGCTGCA
GC
GTTCTCTGTTCTGACAAGACGGGGACTCTGACTGCCAATGAAATGACAGTGACCCAGCTTGTAACGTC
A
GATGGGCTTCGTGCCGAGGTCAGCGGAGTTGGGTATGACGGTCAAGGGACTGTGTGTCTTCTACCATCC
AAG
GAAGTCATTAAGGAATTTTCCAATGTCTCAGTGGGAAAGTTAGTGGAGGCGGGCTGTGTTGCCAACA
AT
GCGGTCATCAGAAAGAACGCCGTGATGGGGCAGCCCACCGAGGGTGCATTGATGGCCCTGGCGATGAA
G
ATGGACTTAAGTGATATTAAAAATTCATATATAAGAAAAAAAGAGATTCCATTCAGTTCAGAGCAGAAG
TGG
ATGGCGGTGAAATGCAGTCTGAAGACTGAGGATCAGGAAGACATTTACTTCATGAAAGGGGCCTTGG
AA
GAGGTGATCCGCTACTGCACCATGTACAACAACGGGGGCATCCCCCTGCCGCTGACGCCCCAGCAGAG
G
TCATTCTGCCTGCAGGAAGAGAAGAGGATGGGGTCGCTCGGTTTGCGGGTGCTGGCCCTGGCTTCTGGG
CCC
GAGCTGGGGCGGCTGACGTTTCTCGGTCTTGTGGGCATCATTGACCCCCCGAGAGTTGGCGTGAAGG
AA
GCAGTCCAGGTTCTCTCCGAGTCTGGTGTGTCTGTGAAGATGATAACGGGGGATGCCCTGGAGACGGC
C
TTGGCCATAGGAAGAAACATCGGCCTGTGCAACGGGAAGCTGCAAGCCATGTCCGGGGAGGAGGTGGAC
AGC
GTGGAGAAGGGCGAGCTGGCCGACCGCGTGGGGAAGGTGTCCGTGTTCTTCAGGACCAGCCCAAAGC
AC
AAGCTCAAAATCATCAAGGCTCTGCAGGAGTCAGGGGCGATCGTGGCCATGACTGGGGATGGGGTGAA
C
GACGCAGTGGCCCTGAAGTCTGCAGACATTGGGATCGCCATGGGGCAGACAGGGACGGACGTCAGCAAA
GAG
GCCGCCAACATGATCCTGGTGGATGATGACTTCTCAGCCATCATGAATGCAGTGGAGGAAGGCAAGG
GT
ATTTTTTACAACATCAAAAACTTTGTCCGATTCCAGCTGAGCACGAGCATCTCCGCCCTGAGTCTCAT
C
ACTCTGTCCACCGTGTTCAACCTGCCCAGCCCCCTCAACGCCATGCAGATCCTATGGATCAACATCATC
ATG
GATGGGCCACCGGCGCAGAGGAGTTCCCAGAAAACTGAAGTGTGTTGCACTGCAGTGAGACTGGGAG
TA
GAAGGCAGAGGAGAAAGTACCTGGGCCGGCAGAGCTGGCTTGGGGGTAGAGCCCGTTGACAAAGACGC
C
TTCAGGCAGCCACCACGGAGTGTGCGGGACACCATCCTCAGCAGAGCCCTCATCCTGAAGATCCTCATG
TCC
GCGGCCATCATCATCAGCGGGACCCTCTTTATCTTCTGGAAGGAGATGCCTGAAGACAGAGCAAGCA
CT
CCCCGCACCACGACGATGACGTTCACTTGTTTTGTGTTTTTCGATCTCTTCAACGCCTTGACCTGCCG
C
TCTCAGACCAAGCTGATATTTGAGATCGGCTTTCTCAGGAACCACATGTTCCTCTACTCCGTCCTGGGG
TCC
ATCCTGGGGCAGCTGGCGGTCATTTACATCCCCCCGCTGCAGAGGGTCTTCCAGACGGAGAACCTGG
GA
GCGCTTGATTTGCTGTTTTTAACTGGATTGGCCTCATCCGTCTTCATTTTGTCAGAGCTCCTCAAACT
A
TGTGAAAAATACTGTTGCAGCCCCAAGAGAGTCCAGATGCACCCTGAAGATGTGTAG


Translation (975 aa):
MVEGRVSEFLKKLGFSGGGRQYQALEKDEEEALIDEQSELKAIEKEKKVTALPPKEACKCQKEDLARAFC
V
DLHTGLSEFSVTQRRLAHGWNEFVADNSEPVWKKYLDQ
FKNPLILLLLGSALVSVLTKEYEDAVSIATA
V
LVVVTVAFIQ
EYRSEKSLEELTKLVPPECNCLREGKLQHLLARELVPGDVVSLSIGDRIPADIRLTEVT
D
LLVDESSFTGEAEPCSKTDSPLTGGGDLTTLSNIVFMGTLVQYGRGQ
GVVIGTGESSQFGEVFKMMQAE
E
TPKTPLQKSMDRLGKQLTLFSFGIIGLIMLIGWSQGKQLLSMFTIGVSLAVAAIPEGLPIVVMVTLVLG
V
LRMAKKRVIVKKLPIVETL
GCCSVLCSDKTGTLTANEMTVTQLVTSDGLRAEVSGVGYDGQGTVCLLPS
K
EVIKEFSNVSVGKLVE
AGCVANNAVIRKNAVMGQPTEGALMALAMKMDLSDIKNSYIRKKEIPFSSEQK
W
MAVKCSLKTE
DQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRMGSLGLRVLALASG
P
ELGRLTFLGLVGIIDPPRVGVKEAVQVLSESGVSVKMITGDALETALAI
GRNIGLCNGKLQAMSGEEVD
S
VEKGELADRVGK
VSVFFRTSPKHKLKIIKALQESGAIVAMTGDGVNDAVALKSADIGIAMGQTGTDVSK
E
AANMILVDDDFSAI
MNAVEEGKGIFYNIKNFVRFQLSTSISALSLITLSTVFNLPSPLNAMQILWINII
M
DGPPAQ
RSSQKTEVCCTAVRLGVEGRGESTWAGRAGLGVEPVDKDAFRQPPRSVRDTILSRALILKILM
S
AAIIISGTLFIFWKE
MPEDRASTPRTTTMTFTCFVFFDLFNALTCRSQTKLIFEIGFLRNHMFLYSVLG
S
ILGQLAVIYIPPLQRVFQTENLGAL
DLLFLTGLASSVFILSELLKLCEKYCCSPKRVQMHPEDV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser