NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS65696.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
65696.1 Public Homo sapiens 1 LY9 24 110 108 CCDS HistoryNCBI Gene:4063Re-query CCDS DB by CCDS ID:65696.1Re-query CCDS DB by GeneID:4063See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 15, NCBI annotation release 105, Ensembl annotation release 74

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 65696.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000392203.8 ENSP00000376039.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000392203.8Link to Ensembl Protein Viewer:ENSP00000376039.4Re-query CCDS DB by Nucleotide ID:ENST00000392203Re-query CCDS DB by Protein ID:ENSP00000376039
Original member Current member NCBI NM_001261457.2 NP_001248386.1 Accepted alive Link to Nucleotide Sequence:NM_001261457.2Link to Protein Sequence:NP_001248386.1Re-query CCDS DB by Nucleotide ID:NM_001261457Re-query CCDS DB by Protein ID:NP_001248386Link to BLAST:NP_001248386.1

Chromosomal Locations for CCDS 65696.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 160796188 160796311 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 160799753 160800082 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 160813636 160813911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 160814420 160814761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 160818218 160818319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 160819321 160819374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 160823465 160823796 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 160824181 160824249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 160827748 160827816 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1698 nt):
ATGGTGGCACCAAAGAGTCACACAGATGACTGGGCTCCTGGGCCTTTCTCCAGTAAGCCACAGAGGAGTC
AG
CTGCAAATATTCTCTTCTGTTCTACAGACCTCTCTCCTCTTCCTGCTCATGGGACTAAGAGCCTCTGG
A
AAGGACTCAGCCCCAACAGTGGTGTCAGGGATCCTAGGGGGTTCCGTGACTCTCCCCCTAAACATCTCA
GTA
GACACAGAGATTGAGAACGTCATCTGGATTGGTCCCAAAAATGCTCTTGCTTTCGCACGTCCCAAAG
AA
AATGTAACCATTATGGTCAAAAGCTACCTGGGCCGACTAGACATCACCAAGTGGAGTTACTCCCTGTG
C
ATCAGCAATCTGACTCTGAATGATGCAGGATCCTACAAAGCCCAGATAAACCAAAGGAATTTTGAAGTC
ACC
ACTGAGGAGGAATTCACCCTGTTCGTCTATGAGCAGCTGCAGGAGCCCCAAGTCACCATGAAGTCTG
TG
AAGGTGTCTGAGAACTTCTCCTGTAACATCACTCTAATGTGCTCCGTGAAGGGGGCAGAGAAAAGTGT
T
CTGTACAGCTGGACCCCAAGGGAACCCCATGCTTCTGAGTCCAATGGAGGCTCCATTCTTACCGTCTCC
CGA
ACACCATGTGACCCAGACCTGCCATACATCTGCACAGCCCAGAACCCCGTCAGCCAGAGAAGCTCCC
TC
CCTGTCCATGTTGGGCAGTTCTGTACAGATCCAGGAGCCTCCAGAGGAGGAACAACGGGGGAGACTGT
G
GTAGGGGTCCTGGGAGAGCCAGTCACCCTGCCACTTGCACTCCCAGCCTGCCGGGACACAGAGAAGGTT
GTC
TGGTTGTTTAACACATCCATCATTAGCAAAGAGAGGGAAGAAGCAGCAACGGCAGATCCACTCATTA
AA
TCCAGGGATCCTTACAAGAACAGGGTGTGGGTCTCCAGCCAGGACTGCTCCCTGAAGATCAGCCAGCT
G
AAGATAGAGGACGCCGGCCCCTACCATGCCTACGTGTGCTCAGAGGCCTCCAGCGTCACCAGCATGACA
CAT
GTCACCCTGCTCATCTACCGACCTGAGAGAAACACAAAGCTTTGGATTGGGTTGTTCCTGATGGTTT
GC
CTTCTGTGCGTTGGGATCTTCAGCTGGTGCATTTGGAAGCGAAAAGGACGGTGTTCAGTCCCAGCCTT
C
TGTTCCAGCCAAGCTGAGGCCCCAGCGGATACACCAGAACCCACAGCTGGCCACACGCTATACTCTGTG
CTC
TCCCAAGGATATGAGAAGCTGGACACTCCCCTCAGGCCTGCCAGGCAACAGCCTACACCCACCTCAG
AC
AGCAGCTCTGACAGCAACCTCACAACTGAGGAGGATGAGGACAGGCCTGAGGTGCACAAGCCCATCAG
T
GGAAGATATGAGGTATTTGACCAGGTCACTCAGGAGGGCGCTGGACATGACCCAGCCCCTGAGGGCCAA
GCA
GACTATGATCCCGTCACTCCATATGTCACGGAAGTTGAGTCTGTGGTTGGAGAGAACACCATGTATG
CA
CAAGTGTTCAACTTACAGGGAAAGACCCCAGTTTCTCAGAAGGAAGAGAGCTCAGCCACAATCTACTG
C
TCCATACGGAAACCTCAGGTGGTGCCACCACCACAACAGAATGATCTTGAGATTCCTGAAAGTCCTACC
TAT
GAAAATTTCACCTGA


Translation (565 aa):
MVAPKSHTDDWAPGPFSSKPQRSQLQIFSSVLQTSLLFLLMGLRASGKDSAPTVVSGILGGSVTLPLNIS
V
DTEIENVIWIGPKNALAFARPKENVTIMVKSYLGRLDITKWSYSLCISNLTLNDAGSYKAQINQRNFEV
T
TEEEFTLFVY
EQLQEPQVTMKSVKVSENFSCNITLMCSVKGAEKSVLYSWTPREPHASESNGGSILTVS
R
TPCDPDLPYICTAQNPVSQRSSLPVHVGQFCT
DPGASRGGTTGETVVGVLGEPVTLPLALPACRDTEKV
V
WLFNTSIISKEREEAATADPLIKSRDPYKNRVWVSSQDCSLKISQLKIEDAGPYHAYVCSEASSVTSMT
H
VTLLIY
RPERNTKLWIGLFLMVCLLCVGIFSWCIWKRKGRCSVPAFCSSQAEAPADTPEPTAGHTLYSV
L
SQGYEKLDTPLRPARQQPTPTSDSSSDSNLTTEEDEDRPEVHKPISGRYEVFDQVTQEGAGHDPAPEGQ
A
DYDPVTPYVTEVESVVGENTMYAQVFNLQ
GKTPVSQKEESSATIYCSIRKPQVVPPPQQNDLEIPESPT
Y
ENFT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser