NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6510.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6510.1 Public Homo sapiens 9 CDKN2A 22 109 92 CCDS HistoryNCBI Gene:1029Re-query CCDS DB by CCDS ID:6510.1Re-query CCDS DB by GeneID:1029See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6510.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000304494.9 ENSP00000307101.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000304494.9Link to Ensembl Protein Viewer:ENSP00000307101.5Re-query CCDS DB by Nucleotide ID:ENST00000304494Re-query CCDS DB by Protein ID:ENSP00000307101
Original member NCBI NM_000077.4 NP_000068.1 Updated not alive Link to Nucleotide Sequence:NM_000077.4Link to Protein Sequence:NP_000068.1Re-query CCDS DB by Nucleotide ID:NM_000077Re-query CCDS DB by Protein ID:NP_000068
Current member NCBI NM_000077.5 NP_000068.1 Accepted alive Link to Nucleotide Sequence:NM_000077.5Link to Protein Sequence:NP_000068.1Re-query CCDS DB by Nucleotide ID:NM_000077Re-query CCDS DB by Protein ID:NP_000068Link to BLAST:NP_000068.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_000068.1 156 P42771-1 156 100% 0 0

Chromosomal Locations for CCDS 6510.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 21968229 21968242 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21970902 21971208 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 21974678 21974827 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (471 nt):
ATGGAGCCGGCGGCGGGGAGCAGCATGGAGCCTTCGGCTGACTGGCTGGCCACGGCCGCGGCCCGGGGTC
GG
GTAGAGGAGGTGCGGGCGCTGCTGGAGGCGGGGGCGCTGCCCAACGCACCGAATAGTTACGGTCGGAG
G
CCGATCCAGGTCATGATGATGGGCAGCGCCCGAGTGGCGGAGCTGCTGCTGCTCCACGGCGCGGAGCCC
AAC
TGCGCCGACCCCGCCACTCTCACCCGACCCGTGCACGACGCTGCCCGGGAGGGCTTCCTGGACACGC
TG
GTGGTGCTGCACCGGGCCGGGGCGCGGCTGGACGTGCGCGATGCCTGGGGCCGTCTGCCCGTGGACCT
G
GCTGAGGAGCTGGGCCATCGCGATGTCGCACGGTACCTGCGCGCGGCTGCGGGGGGCACCAGAGGCAGT
AAC
CATGCCCGCATAGATGCCGCGGAAGGTCCCTCAGACATCCCCGATTGA


Translation (156 aa):
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEP
N
CADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGS
N
HARIDAAEGPS
DIPD



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser