NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS651.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
651.1 Public Homo sapiens 1 CTH 22 109 92 CCDS HistoryNCBI Gene:1491Re-query CCDS DB by CCDS ID:651.1Re-query CCDS DB by GeneID:1491See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 651.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000346806.2 ENSP00000311554.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000346806.2Link to Ensembl Protein Viewer:ENSP00000311554.2Re-query CCDS DB by Nucleotide ID:ENST00000346806Re-query CCDS DB by Protein ID:ENSP00000311554
Original member NCBI NM_153742.4 NP_714964.2 Updated not alive Link to Nucleotide Sequence:NM_153742.4Link to Protein Sequence:NP_714964.2Re-query CCDS DB by Nucleotide ID:NM_153742Re-query CCDS DB by Protein ID:NP_714964
Current member NCBI NM_153742.5 NP_714964.2 Accepted alive Link to Nucleotide Sequence:NM_153742.5Link to Protein Sequence:NP_714964.2Re-query CCDS DB by Nucleotide ID:NM_153742Re-query CCDS DB by Protein ID:NP_714964Link to BLAST:NP_714964.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_714964.2 361 P32929-2 361 100% 0 0

Chromosomal Locations for CCDS 651.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 70411416 70411583 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70415956 70416037 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70417937 70418032 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70421566 70421675 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70429794 70429851 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70430317 70430394 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70432083 70432235 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70433828 70433949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70435125 70435177 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70438688 70438826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70439101 70439127 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1086 nt):
ATGCAGGAAAAAGACGCCTCCTCACAAGGTTTCCTGCCACACTTCCAACATTTCGCCACGCAGGCGATCC
AT
GTGGGCCAGGATCCAGAGCAATGGACCTCCAGGGCTGTAGTGCCCCCCATCTCACTGTCCACCACGTT
C
AAGCAAGGGGCGCCTGGCCAGCACTCGGGTTTTGAATATAGCCGTTCTGGAAATCCCACTAGGAATTGC
CTT
GAAAAAGCAGTGGCAGCACTGGATGGGGCTAAGTACTGTTTGGCCTTTGCTTCAGGTTTAGCAGCCA
CT
GTAACTATTACCCATCTTTTAAAAGCAGGAGACCAAATTATTTGTATGGATGATGTGTATGGAGGTAC
A
AACAGGTACTTCAGGCAAGTGGCATCTGAATTTGGATTAAAGATTTCTTTTGTTGATTGTTCCAAAATC
AAA
TTACTAGAGGCAGCAATTACACCAGAAACCAAGCGCCCTTTGGCTCTGGGAGCTGATATTTCTATGT
AT
TCTGCAACAAAATACATGAATGGCCACAGTGATGTTGTAATGGGCCTGGTGTCTGTTAATTGTGAAAG
C
CTTCATAATAGACTTCGTTTCTTGCAAAACTCTCTTGGAGCAGTTCCATCTCCTATTGATTGTTACCTC
TGC
AATCGAGGTCTGAAGACTCTACATGTCCGAATGGAAAAGCATTTCAAAAACGGAATGGCAGTTGCCC
AG
TTCCTGGAATCTAATCCTTGGGTAGAAAAGGTTATTTATCCTGGGCTGCCCTCTCATCCACAGCATGA
G
TTGGTGAAGCGTCAGTGTACAGGTTGTACAGGGATGGTCACCTTTTATATTAAGGGCACTCTTCAGCAT
GCT
GAGATTTTCCTCAAGAACCTAAAGCTATTTACTCTGGCCGAGAGCTTGGGAGGATTCGAAAGCCTTG
CT
GAGCTTCCGGCAATCATGACTCATGCATCAGTTCTTAAGAATGACAGAGATGTCCTTGGAATTAGTGA
C
ACACTGATTCGACTTTCTGTGGGCTTAGAGGATGAGGAAGACCTACTGGAAGATCTAGATCAAGCTTTG
AAG
GCAGCACACCCTCCAAGTGGAAGTCACAGCTAG


Translation (361 aa):
MQEKDASSQGFLPHFQHFATQAIHVGQDPEQWTSRAVVPPISLSTTFKQGAPGQHSGFEYSRSGNPTRNC
L
EKAVAALDGAKY
CLAFASGLAATVTITHLLKAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKI
K
LLEAAITPETK
RPLALGADISMYSATKYMNGHSDVVMGLVSVNCESLHNRLRFLQNSLGAVPSPIDCYL
C
NRGLKTLHVRMEKHFKNGMAVAQFLESNPWVEKVIYP
GLPSHPQHELVKRQCTGCTGMVTFYIKGTLQH
A
EIFLKNLK
LFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQAL
K
AA
HPPSGSHS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser