NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6474.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6474.1 Public Homo sapiens 9 NFIB 22 109 92 CCDS HistoryNCBI Gene:4781Re-query CCDS DB by CCDS ID:6474.1Re-query CCDS DB by GeneID:4781See the combined annotation on chromosome 9 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6474.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000380959.7 ENSP00000370346.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000380959.7Link to Ensembl Protein Viewer:ENSP00000370346.3Re-query CCDS DB by Nucleotide ID:ENST00000380959Re-query CCDS DB by Protein ID:ENSP00000370346
Original member Current member NCBI NM_005596.3 NP_005587.2 Accepted alive Link to Nucleotide Sequence:NM_005596.3Link to Protein Sequence:NP_005587.2Re-query CCDS DB by Nucleotide ID:NM_005596Re-query CCDS DB by Protein ID:NP_005587Link to BLAST:NP_005587.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_005587.2 420 O00712-1 420 100% 0 0

Chromosomal Locations for CCDS 6474.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 9 (NC_000009.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9See the combined annotation on chromosome 9 in Sequence Viewer

Chromosome Start Stop Links
9 14088309 14088326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 14120440 14120624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 14125632 14125766 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 14146689 14146807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 14150145 14150265 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 14155825 14155893 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 14179727 14179780 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 14306989 14307520 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9
9 14313482 14313511 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 9Link to Ensembl Genome Browser on chromosome 9

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1263 nt):
ATGATGTATTCTCCCATCTGTCTCACTCAGGATGAATTTCACCCATTCATCGAGGCACTTCTTCCACATG
TC
CGTGCAATTGCCTATACTTGGTTCAACCTGCAGGCTCGAAAACGCAAGTACTTTAAAAAGCATGAGAA
G
CGAATGTCAAAGGATGAAGAAAGAGCAGTCAAAGATGAGCTTCTCAGTGAAAAGCCTGAAATCAAACAG
AAG
TGGGCATCCAGGCTCCTTGCCAAACTGCGCAAAGATATTCGCCAGGAGTATCGAGAGGACTTTGTGC
TC
ACCGTGACTGGCAAGAAGCACCCGTGCTGTGTCTTATCCAATCCCGACCAGAAGGGTAAGATTAGGAG
A
ATCGACTGCCTGCGACAGGCAGACAAAGTCTGGCGTCTGGATCTAGTCATGGTGATCCTGTTCAAAGGC
ATC
CCCTTGGAAAGTACCGATGGAGAGCGGCTCATGAAATCCCCACATTGCACAAACCCAGCACTTTGTG
TC
CAGCCACATCATATCACAGTATCAGTTAAGGAGCTTGATTTGTTTTTGGCATACTACGTGCAGGAGCA
A
GATTCTGGACAATCAGGAAGTCCAAGCCACAATGATCCTGCCAAGAATCCTCCAGGTTACCTTGAGGAT
AGT
TTTGTAAAATCTGGAGTCTTCAATGTATCAGAACTTGTAAGAGTATCCAGAACGCCCATAACCCAGG
GA
ACTGGAGTCAACTTCCCAATTGGAGAAATCCCAAGCCAACCATACTATCATGACATGAACTCGGGGGT
C
AATCTTCAGAGGTCTCTGTCTTCTCCACCAAGCAGCAAAAGACCCAAAACTATATCCATAGATGAAAAT
ATG
GAACCAAGTCCTACAGGAGACTTTTACCCCTCTCCAAGTTCACCAGCTGCTGGAAGTCGAACATGGC
AC
GAAAGAGATCAAGATATGTCTTCTCCGACTACTATGAAGAAGCCTGAAAAGCCATTGTTCAGCTCTGC
A
TCTCCACAGGATTCTTCCCCAAGACTGAGCACTTTCCCCCAGCACCACCATCCCGGAATACCTGGAGTT
GCA
CACAGTGTCATCTCAACTCGAACTCCACCTCCACCTTCACCGTTGCCATTTCCAACACAAGCTATCC
TT
CCTCCAGCCCCATCGAGCTACTTTTCTCATCCAACAATCAGATATCCTCCCCACCTGAATCCTCAGGA
T
ACTCTGAAGAACTATGTACCTTCTTATGACCCATCCAGTCCACAAACCAGCCAGTCCTGGTACCTGGGC
TAG


Translation (420 aa):
MMYSPICLTQDEFHPFIEALLPHVRAIAYTWFNLQARKRKYFKKHEKRMSKDEERAVKDELLSEKPEIKQ
K
WASRLLAKLRKDIRQEYREDFVLTVTGKKHPCCVLSNPDQKGKIRRIDCLRQADKVWRLDLVMVILFKG
I
PLESTDGERLMKSPHCTNPALCVQPHHITVSVKELDLFLAYYVQEQ
DSGQSGSPSHNDPAKNPPGYLED
S
FVKSGVFNVSELVRVSR
TPITQGTGVNFPIGEIPSQPYYHDMNSGVNLQRSLSSPPSSKRPKTISIDEN
M
EPSPTGDFYPSPSSPAAGSRTWHERDQ
DMSSPTTMKKPEKPLFSSASPQDSSPRLSTFPQHHHPGIPGV
A
HS
VISTRTPPPPSPLPFPTQAILPPAPSSYFSHPTIRYPPHLNPQDTLKNYVPSYDPSSPQTSQSWYLG



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser