NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS64665.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
64665.1 Public Homo sapiens 7 GUSB 22 109 92 CCDS HistoryNCBI Gene:2990Re-query CCDS DB by CCDS ID:64665.1Re-query CCDS DB by GeneID:2990See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 14, NCBI annotation release 105, Ensembl annotation release 73

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 64665.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000421103.5 ENSP00000391390.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000421103.5Link to Ensembl Protein Viewer:ENSP00000391390.1Re-query CCDS DB by Nucleotide ID:ENST00000421103Re-query CCDS DB by Protein ID:ENSP00000391390
Original member NCBI NM_001284290.1 NP_001271219.1 Updated not alive Link to Nucleotide Sequence:NM_001284290.1Link to Protein Sequence:NP_001271219.1Re-query CCDS DB by Nucleotide ID:NM_001284290Re-query CCDS DB by Protein ID:NP_001271219
Current member NCBI NM_001284290.2 NP_001271219.1 Accepted alive Link to Nucleotide Sequence:NM_001284290.2Link to Protein Sequence:NP_001271219.1Re-query CCDS DB by Nucleotide ID:NM_001284290Re-query CCDS DB by Protein ID:NP_001271219Link to BLAST:NP_001271219.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001271219.1 505 P08236-3 505 100% 0 0

Chromosomal Locations for CCDS 64665.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 7 (NC_000007.14)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 65960897 65961063 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65964323 65964458 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65967731 65967907 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65970282 65970366 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65974295 65974441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65974526 65974704 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65974919 65975071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65979834 65979911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65980224 65980409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7
7 65981974 65982183 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1518 nt):
ATGGCCCGGGGGTCGGCGGTTGCCTGGGCGGCGCTCGGGCCGTTGTTGTGGGGCTGCGCGCTGGGGCTGC
AG
GGCGGGATGCTGTACCCCCAGGAGAGCCCGTCGCGGGAGTGCAAGGAGCTGGACGGCCTCTGGAGCTT
C
CGCGCCGACTTCTCTGACAACCGACGCCGGGGCTTCGAGGAGCAGTGGTACCGGCGGCCGCTGTGGGAG
TCA
GGCCCCACCGTGGACATGCCAGTTCCCTCCAGCTTCAATGACATCAGCCAGGACTGGCGTCTGCGGC
AT
TTTGTCGGCTGGGTGTGGTACGAACGGGAGGTGATCCTGCCGGAGCGATGGACCCAGGACCTGCGCAC
A
AGAGTGGTGCTGAGGATTGGCAGTGCCCATTCCTATGCCATCGTGTGGGTGAATGGGGTCGACACGCTA
GAG
CATGAGGGGGGCTACCTCCCCTTCGAGGCCGACATCAGCAACCTGGTCCAGGTGCAGCTGACTGCAC
AG
ACGTCACTGGGGCCTGTGTCTGACTTCTACACACTCCCTGTGGGGATCCGCACTGTGGCTGTCACCAA
G
AGCCAGTTCCTCATCAATGGGAAACCTTTCTATTTCCACGGTGTCAACAAGCATGAGGATGCGGACATC
CGA
GGGAAGGGCTTCGACTGGCCGCTGCTGGTGAAGGACTTCAACCTGCTTCGCTGGCTTGGTGCCAACG
CT
TTCCGTACCAGCCACTACCCCTATGCAGAGGAAGTGATGCAGATGTGTGACCGCTATGGGATTGTGGT
C
ATCGATGAGTGTCCCGGCGTGGGCCTGGCGCTGCCGCAGTTCTTCAACAACGTTTCTCTGCATCACCAC
ATG
CAGGTGATGGAAGAAGTGGTGCGTAGGGACAAGAACCACCCCGCGGTCGTGATGTGGTCTGTGGCCA
AC
GAGCCTGCGTCCCACCTAGAATCTGCTGGCTACTACTTGAAGATGGTGATCGCTCACACCAAATCCTT
G
GACCCCTCCCGGCCTGTGACCTTTGTGAGCAACTCTAACTATGCAGCAGACAAGGGGGCTCCGTATGTG
GAT
GTGATCTGTTTGAACAGCTACTACTCTTGGTATCACGACTACGGGCACCTGGAGTTGATTCAGCTGC
AG
CTGGCCACCCAGTTTGAGAACTGGTATAAGAAGTATCAGAAGCCCATTATTCAGAGCGAGTATGGAGC
A
GAAACGATTGCAGGGTTTCACCAGGATCCACCTCTGATGTTCACTGAAGAGTACCAGAAAAGTCTGCTA
GAG
CAGTACCATCTGGGTCTGGATCAAAAACGCAGAAAATACGTGGTTGGAGAGCTCATTTGGAATTTTG
CC
GATTTCATGACTGAACAGTCACCGACGAGAGTGCTGGGGAATAAAAAGGGGATCTTCACTCGGCAGAG
A
CAACCAAAAAGTGCAGCGTTCCTTTTGCGAGAGAGATACTGGAAGATTGCCAATGAAACCAGGTATCCC
CAC
TCAGTAGCCAAGTCACAATGTTTGGAAAACAGCCTGTTTACTTGA


Translation (505 aa):
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFEEQWYRRPLWE
S
GPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVVLRIGSAHSYAIV
WVNGVDTL
E
HEGGYLPFEADISNLVQ
VQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADI
R
GKGFDWPLLVKDFNLLRWLGANAFRTSHYPYAEEVMQMCDRYGIVVIDECPGVGLAL
PQFFNNVSLHHH
M
QVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYL
KMVIAHTKSLDPSRPVTFVSNSNYAADKGAPYV
D
VICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSEYGAETIAGFHQ
DPPLMFTEEYQKSLL
E
QYHLGLDQKRRKYVVGELIWNFADFMTEQ
SPTRVLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYP
H
SVAKSQCLENSLFT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser