NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS645.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
645.1 Reviewed, withdrawal pending Homo sapiens 1 LRRC7 22 109 92 CCDS HistoryNCBI Gene:57554Re-query CCDS DB by CCDS ID:645.1Re-query CCDS DB by GeneID:57554See the combined annotation on chromosome 1 in Sequence Viewer

Public Note for CCDS 645.1
This CCDS ID was withdrawn because currently there is insufficient support for the transcript and the protein.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by CCDS collaboration)

Sequence IDs included in CCDS 645.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000035383.9 ENSP00000035383.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000035383.9Link to Ensembl Protein Viewer:ENSP00000035383.5Re-query CCDS DB by Nucleotide ID:ENST00000035383Re-query CCDS DB by Protein ID:ENSP00000035383
Original member NCBI NM_020794.2 NP_065845.1 Removed not alive Link to Nucleotide Sequence:NM_020794.2Link to Protein Sequence:NP_065845.1Re-query CCDS DB by Nucleotide ID:NM_020794Re-query CCDS DB by Protein ID:NP_065845Link to BLAST:NP_065845.1

Chromosomal Locations for CCDS 645.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 69760205 69760393 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 69792043 69792160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 69825748 69825826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 69834780 69834869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 69838227 69838283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 69931507 69931570 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 69980379 69980453 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 69986242 69986386 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 69994561 69994633 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70011797 70011926 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70012974 70013089 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70016465 70016534 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70018719 70018818 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70021005 70021129 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70023126 70023374 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70028171 70028371 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70036121 70036232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70036444 70036624 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70038113 70039793 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70043954 70044094 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70053026 70053145 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70076077 70076298 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70089727 70089819 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70107752 70107826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 70121780 70121887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4614 nt):
ATGACCACCAAACGGAAAATCATCGGCCGTCTGGTGCCATGCCGATGTTTCCGAGGTGAAGAAGAAATCA
TC
TCAGTTTTAGATTACTCCCACTGCAGTCTTCAGCAGGTGCCAAAGGAGGTCTTTAACTTCGAACGAAC
A
TTAGAGGAGCTTTATCTAGATGCCAATCAAATTGAAGAACTACCCAAGCAATTGTTCAACTGTCAAGCT
CTA
CGAAAACTAAGTATTCCTGATAACGACCTTTCAAATCTGCCAACCACTATTGCTAGTTTAGTTAATC
TT
AAAGAACTCGACATCAGTAAAAATGGTGTACAAGAATTTCCAGAAAACATAAAGTGCTGTAAGTGTTT
A
ACAATTATTGAAGCCAGTGTCAATCCCATTTCTAAACTACCTGATGGCTTCACACAGCTCCTAAACCTG
ACC
CAGCTCTACCTGAATGACGCCTTTCTTGAATTTCTTCCAGCCAATTTTGGAAGACTTGTCAAATTGC
GG
ATCTTGGAGTTAAGAGAAAATCACTTGAAAACTCTACCAAAGTCAATGCACAAACTGGCCCAGTTGGA
A
AGACTTGACCTAGGCAATAATGAATTCGGTGAGCTGCCTGAAGTTCTGGATCAAATACAAAATTTGAGG
GAG
TTATGGATGGATAATAATGCATTACAAGTGTTACCTGGGTCTATAGGGAAGTTAAAGATGTTGGTAT
AC
CTGGATATGTCAAAAAACAGAATAGAAACAGTTGACATGGACATTTCTGGATGTGAAGCCCTTGAGGA
C
CTCTTATTGTCATCCAATATGTTGCAACAATTGCCTGATTCTATAGGACTTTTGAAAAAACTAACAACT
CTA
AAAGTAGATGACAATCAACTTACAATGCTACCCAATACAATTGGAAATTTATCTTTATTAGAAGAAT
TT
GACTGTAGCTGTAATGAACTGGAGTCACTACCTTCTACTATTGGCTACCTTCATAGTCTTCGGACATT
A
GCAGTTGATGAGAATTTCCTTCCAGAATTACCCAGAGAAATTGGAAGTTGTAAGAATGTAACAGTCATG
TCT
CTACGCTCCAACAAATTAGAATTTCTTCCTGAAGAGATTGGACAGATGCAGAAACTAAGAGTCCTAA
AT
TTGAGTGACAACAGATTGAAGAATTTACCATTCTCATTTACCAAACTTAAAGAGCTTGCAGCTTTGTG
G
CTTTCTGACAATCAGTCCAAAGCCCTTATCCCTTTACAAACAGAAGCCCATCCAGAAACAAAGCAAAGA
GTA
TTGACTAACTACATGTTTCCCCAGCAGCCTCGTGGTGATGAAGATTTCCAGTCAGACAGTGACAGCT
TT
AACCCTACACTGTGGGAAGAGCAGAGACAACAACGCATGACTGTTGCCTTTGAATTTGAAGACAAAAA
A
GAAGATGACGAAAATGCTGGGAAAGTTAAGGATCTCTCCTGCCAAGCCCCCTGGGAAAGGGGCCAGCGT
GGG
ATTACTCTCCAACCTGCCAGACTGTCTGGCGATTGCTGCACACCATGGGCCAGGTGTGATCAGCAGA
TC
CAAGATATGCCCGTCCCCCAGAATGACCCACAGCTGGCATGGGGTTGTATAAGTGGCCTCCAGCAGGA
A
AGGAGCATGTGTACTCCATTGCCAGTTGCAGCACAATCCACCACTCTTCCCTCTCTAAGTGGCAGACAG
GTT
GAAATAAACCTAAAACGATATCCAACTCCTTACCCAGAGGATTTAAAGAATATGGTAAAATCTGTTC
AA
AATTTGGTGGGTAAGCCAAGCCATGGAGTGCGTGTTGAGAATTCAAATCCAACTGCTAACACGGAGCA
A
ACTGTGAAAGAAAAATATGAACACAAGTGGCCGGTAGCCCCAAAGGAGATTACAGTGGAGGATTCTTTT
GTT
CATCCAGCTAATGAAATGAGGATTGGGGAACTTCACCCTTCATTAGCTGAGACCCCTCTGTACCCAC
CC
AAACTTGTTCTGCTAGGGAAGGACAAAAAAGAATCAACTGATGAGTCTGAAGTTGACAAAACTCACTG
T
CTGAATAACAGTGTTTCCTCAGGCACTTACTCAGACTACTCGCCTTCCCAGGCTTCCTCAGGATCCTCT
AAT
ACCCGGGTTAAAGTGGGGTCCTTGCAGACAACAGCTAAAGATGCAGTACATAATTCTTTGTGGGGTA
AC
AGGATTGCACCATCTTTCCCACAGCCTCTTGATTCAAAGCCATTACTCAGCCAGCGGGAGGCTGTTCC
C
CCAGGCAATATACCACAGCGTCCTGACCGGCTGCCCATGAGTGATACTTTCACTGACAACTGGACTGAT
GGC
TCGCATTATGACAACACAGGGTTTGTTGCTGAGGAAACCACAGCCGAGAATGCCAACAGTAATCCTC
TC
TTAAGTTCGAAATCTAGAAGCACATCTTCGCATGGACGCAGGCCTTTGATCAGGCAAGACAGGATTGT
T
GGTGTTCCCCTGGAACTCGAGCAGTCTACACACAGACACACACCAGAAACAGAAGTGCCTCCTTCCAAT
CCT
TGGCAGAATTGGACCAGAACCCCTAGTCCGTTTGAAGACAGGACCGCTTTTCCTTCCAAATTAGAGA
CA
ACCCCCACTACCAGCCCATTGCCTGAAAGGAAAGAACATATAAAGGAATCTACTGAAATACCTAGTCC
T
TTTTCTCCAGGCGTACCATGGGAGTATCATGATTCCAATCCCAACAGGAGTCTTAGTAATGTCTTTTCT
CAA
ATCCACTGCCGCCCGGAATCTTCTAAAGGTGTTATTTCAATTAGCAAAAGCACAGAGAGGCTTTCCC
CC
CTAATGAAAGATATCAAGTCTAATAAATTCAAAAAGTCACAGAGTATCGATGAGATTGACATTGGTAC
A
TATAAGGTGTATAACATACCATTAGAAAACTATGCTTCTGGGAGTGATCACTTAGGAAGCCACGAACGA
CCG
GATAAGATGCTGGGACCAGAGCATGGTATGTCCAGTATGTCTCGAAGCCAGTCAGTCCCAATGCTGG
AT
GATGAGATGCTCACCTACGGAAGTAGTAAGGGGCCACAACAACAAAAAGCTTCTATGACAAAAAAAGT
C
TATCAGTTTGACCAAAGCTTCAATCCTCAAGGATCAGTGGAAGTGAAAGCCGAAAAGAGGATACCACCC
CCT
TTTCAACACAATCCCGAGTACGTGCAACAGGCCAGCAAAAACATCGCCAAGGATTTGATTAGTCCTA
GA
GCTTACAGAGGATACCCACCGATGGAGCAAATGTTTTCATTTTCTCAGCCATCTGTGAATGAGGATGC
T
GTGGTGAATGCCCAGTTCGCAAGCCAAGGGGCCAGGGCGGGCTTCCTGAGAAGGGCCGACTCCCTGGTG
AGC
GCCACAGAAATGGCCATGTTTAGAAGGGTCAATGAGCCTCATGAGCTGCCCCCAACTGATAGGTACG
GC
AGACCCCCATATAGGGGAGGGCTGGATCGCCAAAGCAGCGTTACAGTGACTGAGTCCCAGTTCCTGAA
A
AGGAATGGCAGGTATGAAGATGAACACCCTTCATATCAAGAAGTGAAAGCTCAGGCGGGAAGTTTTCCG
GTT
AAAAACCTTACCCAAAGGAGGCCATTGTCTGCGAGAAGCTACAGTACAGAGAGTTACGGTGCCTCCC
AA
ACCAGGCCAGTTTCAGCTAGGCCTACTATGGCAGCTCTTTTGGAAAAAATACCATCTGACTATAACTT
G
GGTAACTATGGTGACAAGCCATCAGATAACAGTGATTTAAAGACGAGGCCTACTCCTGTGAAGGGAGAG
GAG
AGCTGTGGTAAAATGCCTGCAGACTGGAGACAACAGCTGCTTAGACATATAGAAGCTAGACGGTTAG
AC
AGGAATGCTGCTTACAAACACAATACAGTTAACCTTGGCATGCTGCCCTATGGAGGTATTTCAGCAAT
G
CATGCAGGCAGAAGCATGACTTTAAACTTGCAGACTAAGTCTAAATTTGATCATCAAGAACTACCTCTT
CAG
AAAACCCCGTCCCAGCAAAGCAACATTTTAGACAATGGACAAGAAGATGTATCTCCTAGTGGCCAAT
GG
AATCCTTATCCACTTGGGAGGCGGGATGTACCTCCGGACACCATTACTAAGAAGGCAGGCAGCCACAT
C
CAGACGTTGATGGGGTCCCAAAGCCTTCAGCATCGCAGCCGGGAGCAGCAGCCGTATGAAGGAAATATA
AAC
AAAGTGACCATCCAGCAATTTCAGTCACCATTGCCTATTCAGATCCCCTCTTCACAGGCCACCCGGG
GA
CCTCAGCCTGGACGGTGCTTAATTCAAACTAAAGGGCAAAGGAGTATGGATGGATATCCAGAGCAGTT
T
TGTGTGAGAATAGAAAAGAATCCTGGCCTTGGATTTAGTATCAGTGGTGGAATTAGTGGACAAGGAAAT
CCA
TTCAAACCTTCTGACAAGGGTATCTTTGTTACTAGGGTTCAGCCTGATGGGCCAGCATCAAACCTAC
TG
CAGCCTGGTGATAAGATCCTTCAGGCAAATGGACACAGTTTTGTACATATGGAACATGAAAAAGCTGT
A
TTACTACTGAAGAGTTTCCAGAACACAGTAGACCTAGTTATTCAACGTGAGCTTACTGTCTAA


Translation (1537 aa):
MTTKRKIIGRLVPCRCFRGEEEIISVLDYSHCSLQQVPKEVFNFERTLEELYLDANQIEELPKQLFNCQA
L
RKLSIPDNDLSNLPTTIASLVNLKELDISKN
GVQEFPENIKCCKCLTIIEASVNPISKLPDGFTQLLNL
T
QLYLNDAFLEFLPANFG
RLVKLRILELRENHLKTLPKSMHKLAQLERLDLGNNEFGELPEVLDQIQNLR
E
LWMDNNALQVLPG
SIGKLKMLVYLDMSKNRIETVDMDISGCEALEDLLLSSNMLQQLPDSIGLLKKLTT
L
KVDDNQLTMLPNTIG
NLSLLEEFDCSCNELESLPSTIGYLHSLRTLAVDENFLPELPREIGSCKNVTVM
S
LRSNKLEFLPEEIGQMQKLRVLNLSDN
RLKNLPFSFTKLKELAALWLSDNQSKALIPLQTEAHPETKQR
V
LTNYMFPQQPRGDE
DFQSDSDSFNPTLWEEQRQQRMTVAFEFEDKKEDDENAGKVKDLSCQAPWERGQR
G
ITLQPARLSGDCCTPWARCDQQIQDMPVPQNDPQLAWGCISGLQQERSMCTPLPVAAQSTTLPSLSGRQ

V
EINLKRYPTPYPEDLKNMVKSVQNLVGKPSHGVRVENSNPTANTEQTVKEKYEHKWPVAPKEITVE
DSF
V
HPANEMRIGELHPSLAETPLYPPKLVLLGKDKK
ESTDESEVDKTHCLNNSVSSGTYSDYSPSQASSGSS
N
TRVKVGSLQTTAKDAVHNSLWGN
RIAPSFPQPLDSKPLLSQREAVPPGNIPQRPDRLPMSDTFTDNWTD
G
SHYDNTGFVAEETTAENANSNPLLSSKSRSTSSHGRRPLIRQDRIVGVPLELEQSTHRHTPETEVPPSN
P
WQNWTRTPSPFEDRTAFPSKLETTPTTSPLPERKEHIKESTEIPSPFSPGVPWEYHDSNPNRSLSNVFS
Q
IHCRPESSKGVISISKSTERLSPLMKDIKSNKFKKSQSIDEIDIGTYKVYNIPLENYASGSDHLGSHER
P
DKMLGPEHGMSSMSRSQSVPMLDDEMLTYGSSKGPQQQKASMTKKVYQFDQSFNPQGSVEVKAEKRIPP
P
FQHNPEYVQQASKNIAKDLISPRAYRGYPPMEQMFSFSQPSVNEDAVVNAQFASQGARAGFLRRADSLV
S
ATEMAMFRRVNEPHELPPTDRYGRPPYRGGLDRQSSVTVTESQFLKRNGRYEDEHPSYQEVKAQAGSFP
V
KNLTQRRPLSARSYSTESYGASQTRPVSARPTMAALLEKIPSDYNLGNYGDKPSDNSDLKTRPTPVKGE
E
SCGKMPADWRQQLLRHIEARRLDR
NAAYKHNTVNLGMLPYGGISAMHAGRSMTLNLQTKSKFDHQELPL
Q
K
TPSQQSNILDNGQEDVSPSGQWNPYPLGRRDVPPDTITKKAGSHIQTLMGSQSLQHRSREQQPYEGNI
N
KVTIQQFQSPLPIQIPSSQATRGPQPGRCLIQTKGQRSMDGYPEQ
FCVRIEKNPGLGFSISGGISGQGN
P
FKPSDK
GIFVTRVQPDGPASNLLQPGDKILQANGHSFVHMEHEKAVLLLKSFQNTVDLVIQRELTV



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser