NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS64082.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
64082.1 Public Homo sapiens 4 FBXW7 22 109 92 CCDS HistoryNCBI Gene:55294Re-query CCDS DB by CCDS ID:64082.1Re-query CCDS DB by GeneID:55294See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 14, NCBI annotation release 105, Ensembl annotation release 73

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 64082.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000604872.6 ENSP00000474751.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000604872.6Link to Ensembl Protein Viewer:ENSP00000474751.1Re-query CCDS DB by Nucleotide ID:ENST00000604872Re-query CCDS DB by Protein ID:ENSP00000474751
Original member Current member NCBI NM_001257069.1 NP_001243998.1 Accepted alive Link to Nucleotide Sequence:NM_001257069.1Link to Protein Sequence:NP_001243998.1Re-query CCDS DB by Nucleotide ID:NM_001257069Re-query CCDS DB by Protein ID:NP_001243998Link to BLAST:NP_001243998.1

Chromosomal Locations for CCDS 64082.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 4 (NC_000004.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 152411273 152411803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (531 nt):
ATGAATCAGGAACTGCTCTCTGTGGGCAGCAAAAGACGACGAACTGGAGGCTCTCTGAGAGGTAACCCTT
CC
TCAAGCCAGGTAGATGAAGAACAGATGAATCGTGTGGTAGAGGAGGAACAGCAACAGCAACTCAGACA
A
CAAGAGGAGGAGCACACTGCAAGGAATGGTGAAGTTGTTGGAGTAGAACCTAGACCTGGAGGCCAAAAT
GAT
TCCCAGCAAGGACAGTTGGAAGAAAACAATAATAGATTTATTTCGGTAGATGAGGACTCCTCAGGAA
AC
CAAGAAGAACAAGAGGAAGATGAAGAACATGCTGGTGAACAAGATGAGGAGGATGAGGAGGAGGAGGA
G
ATGGACCAGGAGAGTGACGATTTTGATCAGTCTGATGATAGTAGCAGAGAAGATGAACATACACATACT
AAC
AGTGTCACGAACTCCAGTAGTATTGTGGACCTGCCCGTTCACCAACTCTCCTCCCCATTCTATACAA
AA
ACAACAAAAGTGAGTATATTCAATATATTGTTAACCTGA


Translation (176 aa):
MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVVGVEPRPGGQN
D
SQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQESDDFDQSDDSSREDEHTHT
N
SVTNSSSIVDLPVHQLSSPFYTKTTKVSIFNILLT




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser