NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS6338.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6338.1 Public Homo sapiens 8 TBC1D31 24 110 108 CCDS HistoryNCBI Gene:93594Re-query CCDS DB by CCDS ID:6338.1Re-query CCDS DB by GeneID:93594See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6338.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000287380.6 ENSP00000287380.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000287380.6Link to Ensembl Protein Viewer:ENSP00000287380.1Re-query CCDS DB by Nucleotide ID:ENST00000287380Re-query CCDS DB by Protein ID:ENSP00000287380
Original member Current member NCBI NM_145647.4 NP_663622.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_145647.4Link to Protein Sequence:NP_663622.2Re-query CCDS DB by Nucleotide ID:NM_145647Re-query CCDS DB by Protein ID:NP_663622Link to BLAST:NP_663622.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_663622.2 1066 Q96DN5-1 1066 100% 0 0

Chromosomal Locations for CCDS 6338.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 123072770 123072846 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123077111 123077257 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123082702 123082817 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123084162 123084340 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123093591 123093742 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123097282 123097441 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123100807 123101007 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123105288 123105464 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123109317 123109396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123109474 123109620 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123120055 123120188 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123126056 123126189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123126508 123126687 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123128281 123128513 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123129066 123129218 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123130198 123130333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123134114 123134206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123140761 123140901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123142262 123142456 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123144717 123144855 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123150036 123150128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 123151806 123151939 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3201 nt):
ATGCAGAGCACTGACCTAGGCAACAAGGAGAGCGGCAAGATATGGCACCGCAAGCCGTCCCCGGCCACGC
GG
GACGGAATTATAGTGAACATTATTCACAACACTTCCGATTACCATCCAAAAGTTTTGCGATTTTTGAA
T
GTGGCTTTTGATGGCACAGGCGACTGCTTAATTGCTGGGGACCACCAAGGAAATATTTATGTTTTTGAC
TTA
CATGGAAACAGGTTCAATCTTGTTCAGCGAACAGCACAAGCTTGCACAGCTCTGGCCTTTAATCTTC
GT
AGGAAATCTGAATTCCTTGTGGCATTAGCTGATTATTCTATTAAATGTTTTGATACAGTCACCAAGGA
G
CTAGTTAGCTGGATGAGAGGACATGAATCATCAGTATTTTCGATCTCTGTGCATGCATCAGGGAAATAT
GCC
ATCACAACTTCTTCTGATACAGCACAATTATGGGACTTGGATACCTTTCAGAGAAAAAGAAAGCTGA
AT
ATTCGCCAGTCTGTGGGTATACAGAAGGTTTTCTTTCTACCATTAAGTAATACCATCCTCAGCTGTTT
T
AAAGATAATTCCATTTTTGCCTGGGAATGTGACACACTTTTTTGCAAATATCAATTGCCAGCTCCACCT
GAA
AGCTCTAGTATATTATACAAAGTGTTTGCTGTAACCAGAGATGGCCGAATCCTGGCTGCTGGAGGCA
AG
TCAAATCATCTTCATTTGTGGTGCTTGGAAGCTAGGCAGCTCTTTAGAATTATCCAGATGCCCACTAA
A
GTTCGAGCCATTCGCCATCTGGAATTTCTTCCTGATAGTTTTGATGCTGGTTCTAATCAGGTTCTTGGA
GTA
CTAAGTCAAGATGGTATTATGAGATTTATCAATATGCAGACTTGTAAACTTCTCTTTGAGATTGGGA
GC
CTCGATGAAGGAATTAGCTCATCAGCAATTAGCCCACATGGACGGTACATTGCATCTATTATGGAAAA
T
GGAAGTCTAAACATATATTCAGTTCAGGCTTTAACACAAGAAATAAATAAGCCACCTCCGCCTTTAGTG
AAA
GTTATTGAAGATTTGCCCAAGAATAAACTGAGTTCCAGTGATCTTAAGATGAAAGTAACATCAGGGA
GA
GTACAGCAGCCAGCAAAATCTAGGGAAAGCAAAATGCAAACTAGAATATTAAAACAAGACCTGACTGG
T
GATTTTGAAAGTAAAAAGAATGAATTACCAGATGGATTAAACAAAAAGCGTTTACAAATCTTATTAAAA
GGC
TATGGTGAATATCCAACAAAATACAGAATGTTCATTTGGCGCTCTCTGCTACAACTGCCTGAAAATC
AT
ACTGCGTTTAGTACCCTCATAGATAAGGGGACTCATGTGGCATTTCTCAACCTTCAGAAGAAATACCC
C
ATCAAAAGTAGGAAGCTACTCAGAGTATTACAGAGAACCTTATCTGCATTAGCTCACTGGTCTGTCATT
TTT
AGTGACACACCATATCTTCCACTCTTGGCATTTCCATTTGTAAAATTATTCCAGAACAACCAACTCA
TC
TGTTTTGAAGTTATTGCTACTCTCATAATCAATTGGTGTCAACACTGGTTTGAATATTTTCCTAATCC
T
CCTATCAATATTCTTAGCATGATAGAAAATGTTTTGGCATTTCATGACAAGGAACTGCTGCAACACTTC
ATA
GATCATGATATAACCTCCCAGCTATATGCATGGCCTCTTCTTGAAACTGTGTTCTCAGAAGTGCTGA
CA
AGAGAGGAGTGGCTGAAATTGTTCGATAATATCTTTTCCAACCATCCTTCCTTCCTTCTGATGACTGT
T
GTAGCCTACAACATATGTTCTAGAACGCCTCTGCTCAGCTGTAATCTTAAAGATGACTTTGAGTTTTTT
TTT
CACCATCGGAATAACCTGGATATAAATGTTGTGATTAGACAAGTTTATCATCTCATGGAGACCACGC
CT
ACTGACATTCATCCAGACAGCATGCTTAATGTTTTTGTTGCACTGACAAAAGGGCAGTATCCAGTATT
T
AATCAATATCCAAAGTTTATTGTGGACTATCAAACACAGGAACGAGAAAGAATAAGGAATGATGAATTG
GAT
TACTTAAGAGAGAGGCAGACAGTTGAAGATATGCAAGCTAAAGTCGACCAGCAAAGAGTTGAAGATG
AA
GCTTGGTACCAGAAACAGGAGCTGCTTCGTAAAGCTGAAGAAACAAGAAGAGAAATGCTCTTACAAGA
G
GAGGAGAAAATGATACAACAAAGACAGAGGCTAGCTGCTGTGAAAAGAGAGCTGAAAGTAAAGGAAATG
CAC
TTACAAGATGCTGCAAGAAGGCGTTTTCTGAAGCTTCAGCAAGATCAACAGGAAATGGAACTAAGAA
GA
CTGGATGATGAAATTGGGAGAAAGGTATATATGAGAGATCGAGAAATTGCTGCCACAGCCAGAGACCT
A
GAAATGAGACAGCTGGAACTCGAATCACAAAAGAGACTTTATGAGAAGAATCTTACTGAAAATCAAGAA
GCT
CTTGCAAAAGAAATGCGAGCAGATGCAGATGCCTATAGACGAAAAGTGGATCTTGAAGAACACATGT
TT
CATAAGCTGATAGAAGCAGGTGAAACCCAGAGCCAGAAAACTCAGAAGGTGATTAAAGAAAATTTGGC
A
AAGGCTGAACAAGCATGCCTAAATACCGACTGGCAGATTCAGTCTTTACATAAACAAAAATGTGATGAT
CTA
CAACGAAACAAATGTTACCAGGAAGTAGCCAAACTCCTTAGGGAAAACAGAAGGAAAGAAATAGAGA
TA
ATAAATGCAATGGTGGAGGAGGAAGCCAAGAAGTGGAAGGAAGCTGAAGGAAAAGAGTTCCGTTTGAG
A
TCAGCAAAGAAAGCTTCTGCTCTTTCAGATGCGTCTAGAAAGTGGTTTTTAAAGCAAGAGATAAATGCG
GCT
GTAGAACATGCTGAAAATCCATGTCATAAAGAAGAACCCAGGTTCCAAAATGAACAGGACTCAAGCT
GT
TTGCCTAGAACCTCACAATTAAATGACTCTTCTGAAATGGATCCCTCAACACAGATTTCTTTAAATAG
A
AGAGCAGTAGAATGGGACACCACGGGACAGAATCTTATTAAGAAAGTGAGAAATCTTCGCCAGAGACTC
ACT
GCCCGGGCTCGTCACAGATGTCAAACCCCTCATCTTTTGGCTGCATAG


Translation (1066 aa):
MQSTDLGNKESGKIWHRKPSPATRDGIIVNIIHNTSDYHPKVLRFLNVAFDGTGDCLIAGDHQGNIYVFD
L
HGN
RFNLVQRTAQACTALAFNLRRKSEFLVALADYSIKCFDTVTKELVSWMRGHESSVFSISVHASGKY
A
ITTSSDTAQLWDLDTFQRKRKLNIRQSVGIQK
VFFLPLSNTILSCFKDNSIFAWECDTLFCKYQLPAPP
E
SSSILYKVFAVT
RDGRILAAGGKSNHLHLWCLEARQLFRIIQMPTKVRAIRHLEFLPDSFDAGSNQVLG
V
LSQDGIMRFINMQTCKLLFEIGSLDEGISSSAISPHGRYIASIMENGSLNIYSVQALTQEINK
PPPPLV
K
VIEDLPKNKLSSSDLKMKVTSGRVQQPAKSRESKMQTRILKQDLTGDFESKK
NELPDGLNKKRLQILLK
G
YGEYPTKY
RMFIWRSLLQLPENHTAFSTLIDKGTHVAFLNLQKKYPIKSRKLLRVLQRTLSALAHWSVI
F
SDTPYLPLLAFPFVKLFQNNQLICFEVIATLI
INWCQHWFEYFPNPPINILSMIENVLAFHDKELLQHF
I
DHDITSQ
LYAWPLLETVFSEVLTREEWLKLFDNIFSNHPSFLLMTVVAYNICSRTPLLSCNLKDDFEFF
F
HHRNNLDINVVIRQVYHLMETTPTDIHPDSMLNVFVALTKGQYPVFNQYPKFIVDYQTQERERIRNDEL
D
YLRE
RQTVEDMQAKVDQQRVEDEAWYQKQELLRKAEETRREMLLQEEEKMIQQRQRLAAVKRELKVKEM
H
LQDAARRRFLKLQQDQQEMELRRLDDEIGRK
VYMRDREIAATARDLEMRQLELESQKRLYEKNLTENQE
A
LAKEMRADADAYRRKVDLEEHMFHKLIEAGETQSQKTQK
VIKENLAKAEQACLNTDWQIQSLHKQKCDD
L
QRNKCYQEVAKLLRENRRKEIEIINAMVEEEAKK
WKEAEGKEFRLRSAKKASALSDASRKWFLKQEINA
A
VEHAENPCHK
EEPRFQNEQDSSCLPRTSQLNDSSEMDPSTQISLNRRAVEWDTTGQNLIKKVRNLRQRL
T
ARARHRCQTPHLLAA




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser