NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS6258.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6258.2 Public Homo sapiens 8 TMEM67 22 109 92 CCDS HistoryNCBI Gene:91147Re-query CCDS DB by CCDS ID:6258.2Re-query CCDS DB by GeneID:91147See the combined annotation on chromosome 8 in Sequence Viewer

Public Note for CCDS 6258.1
The coding region has been updated to extend the N-terminus to one that is more supported by available conservation and transcript data.

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 6258.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000453321.7 ENSP00000389998.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000453321.7Link to Ensembl Protein Viewer:ENSP00000389998.3Re-query CCDS DB by Nucleotide ID:ENST00000453321Re-query CCDS DB by Protein ID:ENSP00000389998
Original member Current member NCBI NM_153704.5 NP_714915.3 Accepted alive Link to Nucleotide Sequence:NM_153704.5Link to Protein Sequence:NP_714915.3Re-query CCDS DB by Nucleotide ID:NM_153704Re-query CCDS DB by Protein ID:NP_714915Link to BLAST:NP_714915.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_714915.3 995 Q5HYA8-1 995 100% 0 0

Chromosomal Locations for CCDS 6258.2

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 93754915 93755137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93755778 93755866 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93758483 93758576 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93763842 93763941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93765406 93765475 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93765572 93765646 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93772589 93772651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93780593 93780747 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93780874 93780982 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93781658 93781744 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93782395 93782460 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93785222 93785378 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93786223 93786346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93787844 93787949 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93791263 93791319 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93793198 93793296 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93795409 93795507 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93795901 93795987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93797134 93797233 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93797331 93797470 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93799618 93799758 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93803604 93803684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93804762 93804878 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93808840 93808956 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93809057 93809161 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93809785 93809887 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93815305 93815447 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 93816372 93816452 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2988 nt):
ATGGCGACGCGCGGTGGGGCTGGGGTGGCAATGGCGGTTTGGTCCCTCTTATCCGCCCGGGCCGTGACCG
CG
TTCCTTCTGTTGTTCCTCCCTCGCTTCTTACAGGCCCAGACCTTCTCTTTCCCTTTCCAGCAGCCGGA
G
AAGTGCGACAACAACCAGTACTTTGATATCTCCGCCCTCTCGTGTGTTCCTTGTGGAGCTAACCAGAGG
CAA
GATGCCCGAGGAACTTCATGTGTATGTCTACCAGGATTTCAGATGATCTCTAATAATGGAGGACCTG
CT
ATTATTTGTAAAAAGTGCCCAGAAAACATGAAAGGTGTTACAGAAGATGGCTGGAACTGCATTTCTTG
C
CCTAGTGACTTAACTGCCGAAGGAAAATGTCACTGTCCCATTGGCCATATTTTAGTGGAAAGAGACATT
AAT
GGAACATTGTTGTCTCAAGCAACTTGTGAGCTCTGTGATGGAAATGAAAACTCTTTTATGGTAGTAA
AT
GCTTTAGGAGACAGGTGCGTCCGATGTGAGCCAACATTTGTTAATACCAGCAGGTCCTGTGCATGTTC
A
GAACCTAACATTTTAACAGGGGGATTATGTTTCAGCAGCACAGGGAATTTTCCTCTACGTAGAATTTCA
GCT
GCACGTTATGGAGAAGTTGGCATGTCTTTAACTTCAGAATGGTTTGCAAAGTATTTGCAATCATCAG
CA
GCTGCATGTTGGGTATATGCCAATCTAACATCTTGTCAAGCTCTTGGAAATATGTGTGTGATGAACAT
G
AATTCTTACGACTTTGCCACATTTGATGCATGTGGACTATTTCAGTTTATCTTTGAAAATACTGCTGGA
CTG
AGCACTGTTCATTCTATTTCATTTTGGAGACAGAATCTTCCTTGGCTGTTTTATGGAGACCAGTTAG
GA
TTAGCACCTCAAGTGCTCAGTTCTACCTCTCTTCCTACAAATTTCAGTTTTAAAGGAGAAAACCAGAA
T
ACAAAACTGAAGTTTGTTGCTGCTTCCTATGATATAAGAGGAAATTTTCTCAAGTGGCAAACTTTAGAA
GGA
GGTGTTTTACAGCTTTGTCCAGACACAGAGACAAGGCTAAATGCTGCTTATTCATTTGGAACAACCT
AC
CAACAAAATTGTGAGATTCCTATCTCTAAGATCTTAATTGACTTTCCCACTCCTATATTTTATGATGT
G
TACCTTGAATATACTGATGAAAATCAACATCAATATATTTTGGCTGTGCCTGTGTTAAACCTAAATCTT
CAA
CATAATAAGATATTTGTGAACCAAGACAGCAACTCTGGAAAGTGGCTTCTAACTCGGCGCATTTTCT
TA
GTGGATGCAGTAAGTGGACGAGAAAATGACTTAGGAACTCAGCCAAGAGTAATTCGAGTTGCTACTCA
A
ATATCACTGAGTGTCCACCTTGTACCCAACACAATAAATGGAAACATCTACCCTCCCTTAATCACCATT
GCC
TACAGTGACATTGATATCAAAGATGCCAACAGCCAGTCTGTGAAGGTTTCTTTCTCAGTCACATATG
AA
ATGGATCATGGAGAAGCACATGTCCAGACAGATATTGCTTTGGGTGTATTGGGTGGGCTAGCTGTTTT
A
GCATCTCTTTTGAAGACAGCAGGATGGAAGAGGCGCATTGGGAGTCCCATGATTGATTTACAGACAGTT
GTG
AAATTCTTGGTGTACTATGCTGGTGATCTGGCCAATGTTTTCTTTATCATCACAGTGGGAACAGGTC
TT
TACTGGCTTATTTTCTTCAAAGCACAGAAGTCTGTGTCTGTTTTGCTGCCAATGCCAATTCAGGAAGA
A
CGTTTTGTCACTTATGTTGGATGTGCCTTTGCTCTGAAGGCACTACAATTTTTGCATAAGCTCATATCC
CAG
ATTACAATAGATGTATTCTTTATTGATTGGGAGCGACCTAAAGGAAAGGTTCTTAAAGCTGTTGAAG
GT
GAGGGTGGTGTACGAAGTGCCACTGTTCCTGTAAGCATATGGAGAACATATTTTGTAGCAAATGAATG
G
AATGAAATTCAGACTGTGAGAAAAATTAATTCACTCTTTCAAGTACTTACTGTCCTCTTCTTTTTGGAG
GTT
GTGGGATTCAAGAACTTAGCATTAATGGACTCATCTTCTAGTCTTTCTAGAAACCCACCTAGCTACA
TA
GCTCCTTATAGCTGCATTTTGAGATATGCAGTGTCTGCTGCTCTTTGGCTAGCCATTGGAATTATACA
G
GTCGTGTTCTTTGCTGTCTTTTATGAGAGATTTATAGAAGATAAAATTCGACAGTTCGTTGATTTATGC
TCT
ATGAGTAATATATCAGTGTTTCTGTTATCCCACAAATGTTTTGGATATTACATTCATGGTAGATCAG
TA
CATGGGCATGCAGATACTAATATGGAAGAAATGAATATGAACCTTAAAAGAGAAGCGGAAAATTTGTG
T
AGCCAGAGAGGTTTGGTACCCAACACAGATGGTCAGACTTTTGAGATTGCAATTTCTAACCAGATGAGA
CAA
CATTATGACAGAATTCATGAGACACTAATAAGGAAAAATGGTCCTGCTAGACTACTGAGTTCATCAG
CA
AGTACTTTTGAGCAGAGTATAAAAGCATATCATATGATGAATAAATTTCTTGGCTCCTTCATTGACCA
T
GTTCATAAGGAAATGGATTACTTTATAAAAGATAAGTTGCTTCTTGAAAGAATTCTTGGAATGGAATTC
ATG
GAACCAATGGAAAAAAGCATCTTTTACAATGATGAAGGTTATTCTTTCAGCAGTGTCCTGTATTATG
GA
AATGAAGCTACTCTTCTTATTTTTGATCTGCTGTTCTTCTGTGTTGTGGATTTGGCTTGCCAAAATTT
T
ATTTTAGCATCCTTCCTTACATATCTACAACAAGAGATTTTTAGATATATCCGTAATACAGTAGGACAA
AAG
AATTTGGCATCCAAAACATTGGTGGATCAAAGATTTTTGATTTAA


Translation (995 aa):
MATRGGAGVAMAVWSLLSARAVTAFLLLFLPRFLQAQTFSFPFQQPEKCDNNQYFDISALSCVPCGANQR
Q
DAR
GTSCVCLPGFQMISNNGGPAIICKKCPENMKGVTEDGWNCISCPSDLTAEGKCHCPIGHILVERDI
N
GTLLSQATCELCDGNENSFMVVNALGD
RCVRCEPTFVNTSRSCACSEPNILTGGLCFSSTGNFPLRRIS
A
ARYGEV
GMSLTSEWFAKYLQSSAAACWVYANLTSCQALGNMCVMNMNSYDFATFDACGLFQFIFENTAG
L
STVHSISF
WRQNLPWLFYGDQLGLAPQVLSSTSLPTNFSFKGENQNTKLKFVAASYDIRGNFLKWQTLE
G
GVLQ
LCPDTETRLNAAYSFGTTYQQNCEIPISKILIDFPTPIFYDVYLEYTDENQHQYILAVPVLNLNL
Q
HNKIFVNQ
DSNSGKWLLTRRIFLVDAVSGRENDLGTQPRVIRVATQISLSVHLVPNTINGNIYPPLITI
A
YSDIDIKDANSQSVK
VSFSVTYEMDHGEAHVQTDIALGVLGGLAVLASLLKTAGWKRRIGSPMIDLQTV
V
KFLVYYAGDLANVFFIITVGTGLYWLIFFK
AQKSVSVLLPMPIQEERFVTYVGCAFALKALQFLHKLIS
Q
ITIDVFFIDWERPKGKVLKAVE
GEGGVRSATVPVSIWRTYFVANEWNEIQTVRKINSLFQVLTVLFFLE
V
VGFKNLALMDSSSSLSRNPPSYIAPYSCILRYAVSAALWLAIGIIQ
VVFFAVFYERFIEDKIRQFVDLC
S
MSN
ISVFLLSHKCFGYYIHGRSVHGHADTNMEEMNMNLKREAENLCSQRGLVPNTDGQTFEIAISNQMR
Q
HYDRIHETLIR
KNGPARLLSSSASTFEQSIKAYHMMNKFLGSFIDHVHKEMDYFIKDKLLLERILGMEF
M
EPMEKSIFYN
DEGYSFSSVLYYGNEATLLIFDLLFFCVVDLACQNFILASFLTYLQQEIFRYIRNTVGQ
K
NLASKTLVDQRFLI




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser