NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS62007.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
62007.1 Public Homo sapiens 16 GSE1 22 109 92 CCDS HistoryNCBI Gene:23199Re-query CCDS DB by CCDS ID:62007.1Re-query CCDS DB by GeneID:23199See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 14, NCBI annotation release 105, Ensembl annotation release 73

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 62007.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000393243.5 ENSP00000376934.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000393243.5Link to Ensembl Protein Viewer:ENSP00000376934.1Re-query CCDS DB by Nucleotide ID:ENST00000393243Re-query CCDS DB by Protein ID:ENSP00000376934
Original member NCBI NM_001278184.2 NP_001265113.1 Updated not alive Link to Nucleotide Sequence:NM_001278184.2Link to Protein Sequence:NP_001265113.1Re-query CCDS DB by Nucleotide ID:NM_001278184Re-query CCDS DB by Protein ID:NP_001265113
Current member NCBI NM_001278184.3 NP_001265113.1 Accepted alive Link to Nucleotide Sequence:NM_001278184.3Link to Protein Sequence:NP_001265113.1Re-query CCDS DB by Nucleotide ID:NM_001278184Re-query CCDS DB by Protein ID:NP_001265113Link to BLAST:NP_001265113.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001265113.1 1144 Q14687-3 1144 100% 0 0

Chromosomal Locations for CCDS 62007.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 85613392 85613398 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85648552 85648751 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85654278 85654450 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85654794 85654991 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85655726 85655917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85656343 85656665 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85657277 85657604 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85661146 85661765 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85662981 85663093 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85663344 85663614 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85665015 85665128 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85665976 85666347 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85668140 85668424 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85670995 85671098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16
16 85672405 85672539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3435 nt):
ATGAAAGGGTCCTCACTGAGCAGCGAGTCGTCCCCCGTGTCCTCTCCGGCCACCAACCACAGCTCCCCCG
CC
AGCACACCCAAGCGCGTGCCCATGGGCCCTATCATCGTCCCCCCTGGGGGCCACAGCGTGCCCAGCAC
C
CCCCCCGTGGTGACCATCGCTCCAACCAAAACCGTGAATGGTGTCTGGAGGAGTGAGAGCCGGCAGGAT
GCC
GGCTCCAGGAGCAGCAGTGGAGGTCGGGAACGCCTCATTGTGGAGCCCCCGCTCCCTCAGGAGAAGG
CA
GGGGGACCAGCCATCCCCTCGCACCTGCTCAGCACCCCCTACCCCTTCGGCCTCTCCCCCAGCTCAGT
T
GTGCAGGATTCCCGCTTCCCGCCACTCAACCTCCAGCGGCCCGTGCACCACGTGGTGCCCCCCAGTACC
GTG
ACCGAGGACTACCTGAGAAGCTTCCGGCCCTACCACACCACCGACGACCTCCGCATGTCCTCACTGC
CT
CCCCTCGGCCTGGACCCGGCCACTGCTGCAGCCTACTACCACCCCAGCTACCTGGCCCCACACCCCTT
C
CCCCACCCGGCCTTCAGGATGGACGACTCCTACTGCCTGTCTGCCCTGAGGTCCCCGTTCTACCCCATC
CCC
ACCCCCGGCTCCCTGCCCCCACTGCACCCATCAGCGATGCACCTGCACCTCTCTGGGGTCCGCTACC
CT
CCCGAGCTCTCCCACTCATCCCTGGCAGCGCTGCACTCGGAGCGCATGTCTGGCCTCAGCGCGGAGAG
G
CTGCAGATGGACGAGGAGCTAAGGCGGGAGAGGGAGCGCGAGCGCGAGCGCGAGCGTGAGCGTGAGGCT
GAC
CGCGAGCGGGAGAAGGAACGTGAGCGCGAACGCGAGAAGGAGCGCGAGCAAGAGAAGGAGCGTGAGC
GT
GAGAAGGAGCGCGAGCGCGAGCTGGAGCGCCAGCGGGAGCAGCGGGCCCGGGAGAAGGAGCTGCTGGC
C
GCCAAGGCCCTGGAGCCCAGCTTCCTGCCCGTGGCCGAGCTGCATGGGCTGCGTGGCCATGCCACTGAG
GAG
CGGGGCAAGCCCTCGGAGCAGCTGACCCCAACCCGAGCAGAGAAGCTGAAGGATGCCGGCCTGCAGG
CG
CCCAAGCCCGTCCAACACCCCTTGCATCCGGTGCCCACCCCACACCACACGGTGCCCAGCCTCATCTC
C
AACCATGGCATCTTCTCTCTGCCTAGCAGCAGTGCTGCCACAGCCCTGCTGATCCAGCGCACCAATGAG
GAG
GAGAAGTGGCTGGCGCGGCAGCGGCGGCTGCGGCAGGAGAAGGAGGACCGGCAGTCTCAGGTGTCCG
AG
TTCCGGCAGCAGGTGCTGGAGCAGCACCTGGATATGGGCCGGCCCCCGGTGCCGGCGGAGGCAGAGCA
C
AGGCCGGAGAGCACCACCAGGCCAGGACCAAACCGTCACGAGCCAGGTGGCCGTGACCCTCCGCAGCAC
TTT
GGGGGGCCACCACCTCTGATTTCGCCCAAGCCCCAGCTCCATGCTGCACCCACGGCCCTCTGGAACC
CC
GTGTCCCTGATGGACAACACCTTGGAGACGCGGCGGGCCGAAAGCCACTCTCTGCACAGCCACCCGGC
T
GCATTTGAGCCCAGCCGCCAGGCAGCCGTGCCGCTGGTGAAGGTGGAGCGGGTCTTCTGCCCGGAGAAA
GCA
GAGGAGGGGCCACGGAAGCGTGAGCCTGCCCCTCTGGACAAGTACCAGCCACCTCCGCCGCCACCAC
GA
GAGGGAGGGAGCCTGGAGCACCAGCCCTTCCTGCCCGGGCCCGGGCCCTTCCTGGCTGAGCTCGAGAA
G
TCCACCCAGACCATCCTGGGCCAGCAGCGGGCCTCCCTCCCACAGGCGGCCACCTTCGGGGAGCTCAGC
GGA
CCCCTGAAGCCTGGCTCGCCCTACCGGCCCCCAGTGCCACGGGCCCCCGACCCTGCCTACATCTATG
AT
GAGTTCCTGCAGCAGCGCCGGAGGCTGGTCAGCAAGCTGGACCTGGAGGAGCGCAGGCGGCGGGAGGC
C
CAGGAGAAAGGGTACTACTACGACCTCGATGACTCTTACGACGAGAGCGATGAGGAGGAGGTCAGGGCC
CAC
CTCCGTTGCGTGGCCGAGCAGCCGCCCCTCAAACTGGACACGTCCTCTGAGAAGCTAGAGTTTTTGC
AA
CTTTTTGGCTTGACCACCCAACAGCAGAAGGAGGAATTGGTGGCCCAGAAGCGGAGGAAGCGGCGGAG
G
ATGCTGCGAGAGAGAAGCCCGTCGCCCCCAACAATTCAGAGCAAGCGGCAGACGCCTTCACCGAGACTG
GCG
CTGTCTACCCGCTACAGCCCTGATGAGATGAACAACAGTCCCAACTTCGAAGAAAAGAAGAAGTTCC
TG
ACCATCTTCAACCTGACCCACATCAGCGCTGAGAAGAGGAAAGACAAAGAGAGACTTGTTGAAATGCT
C
CGTGCCATGAAGCAGAAGGCACTGTCAGCAGCAGTGGCCGACTCCTTGACAAACTCTCCGAGGGACAGT
CCT
GCCGTCTCCCTGAGTGAACCAGCCACGCAGCAAGCCTCTCTGGATGTGGAGAAGCCGGTTGGTGTTG
CT
GCTTCCTTGTCTGACATCCCAAAGGCCGCGGAGCCTGGGAAGCTGGAACAGGTCCGGCCCCAGGAGCT
G
TCGAGAGTCCAGGAGCTAGCTCCTGCCAGCGGGGAGAAGGCCAGGCTGAGCGAGGCCCCTGGAGGCAAA
AAG
AGTCTGAGCATGCTTCACTATATCCGGGGCGCTGCACCCAAGGACATTCCTGTGCCGCTGTCCCACA
GC
ACCAATGGGAAGAGCAAGCCGTGGGAGCCCTTTGTGGCAGAAGAGTTTGCACATCAGTTCCACGAGTC
A
GTGCTGCAGTCCACCCAGAAGGCCCTGCAGAAGCATAAAGGGAGCGTGGCTGTGCTGTCTGCAGAGCAG
AAC
CACAAGGTTGACACGTCCGTCCACTACAACATTCCTGAGCTGCAGTCCTCCAGCCGCGCCCCTCCAC
CC
CAGCACAATGGGCAGCAGGAGCCCCCCACTGCAAGGAAGGGCCCCCCAACCCAGGAGTTGGACCGGGA
C
TCGGAGGAGGAGGAAGAGGAGGATGATGAAGATGGAGAAGATGAGGAGGAAGTCCCCAAGCGCAAGTGG
CAA
GGGATCGAGGCCGTTTTTGAAGCTTACCAGGAACACATAGAAGAGCAAAATCTGGAGCGGCAGGTGT
TA
CAGACACAATGTAGACGACTGGAGGCCCGGCACTACAGCCTCAGCCTGACGGCAGAGCAGCTCTCCCA
C
AGCGTGGCGGAGTTGAGGAGCCAGAAACAGAAGATGGTCTCAGAAAGGGAGCGGCTCCAGGCAGAACTG
GAC
CACTTACGAAAGTGCCTTGCCTTGCCTGCAATGCACTGGCCTAGGGGCTACCTGAAGGGATATCCCA
GG
TGA


Translation (1144 aa):
MKGSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPSTPPVVTIAPTKTVNGVWRSESRQD
A
GSRSSSGGRERLIVEPPLPQEKAGGPAIPSHLLSTPYPFGLSPSSVVQDSRFPPL
NLQRPVHHVVPPST
V
TEDYLRSFRPYHTTDDLRMSSLPPLGLDPATAAAYYHPSYLAPHPFPHPAF
RMDDSYCLSALRSPFYPI
P
TPGSLPPLHPSAMHLHLSGVRYPPELSHSSLAALHSERMSGLSAE
RLQMDEELRREREREREREREREA
D
REREKEREREREKEREQEKEREREKERERELERQREQRAREKELLAAKALEPSFLPVAELHGLRGHATE
E
RGKPSEQLTPTRA
EKLKDAGLQAPKPVQHPLHPVPTPHHTVPSLISNHGIFSLPSSSAATALLIQRTNE
E
EKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDMGRPPVPAEAEHRPESTT
RPGPNRHEPGGRDPPQH
F
GGPPPLISPKPQLHAAPTALWNPVSLMDNTLETRRAESHSLHSHPAAFEPSRQAAVPLVKVERVFCPEK
A
EEGPRKREPAPLDKYQPPPPPPREGGSLEHQPFLPGPGPFLAELEKSTQTILGQQRASLPQAATFGELS
G
PLKPGSPYRPPVPRAPDPAYIYDEFLQQRRRLVSKLDLEERRRREAQEK
GYYYDLDDSYDESDEEEVRA
H
LRCVAEQPPLKLDTSSE
KLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPTIQSKRQTPSPRL
A
LSTRYSPDEMNNSPNFEEKKKFLTIFNLTHISAEKRK
DKERLVEMLRAMKQKALSAAVADSLTNSPRDS
P
AVSLS
EPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQELSRVQELAPASGEKARLSEAPGGK
K
SLSMLHYIRGAAPKDIPVPLSHSTNGKSKPWEPFVAEEFAHQFHESVLQSTQKALQKHK
GSVAVLSAEQ
N
HKVDTSVHYNIPELQSSSRAPPPQHNGQQEPPTARKGPPTQELDRDSEEEEEEDDEDGEDEEEVPKRKW
Q
GIEAVFEAYQEHIE
EQNLERQVLQTQCRRLEARHYSLSLTAEQLSHSVAELRSQKQKMVSERERLQAEL
D
HLRKCLALPAMHWPRGYLKGYPR




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser