NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS60880.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
60880.1 Public Homo sapiens 11 ANAPC15 22 109 92 CCDS HistoryNCBI Gene:25906Re-query CCDS DB by CCDS ID:60880.1Re-query CCDS DB by GeneID:25906See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 14, NCBI annotation release 105, Ensembl annotation release 73

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 60880.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000543587.5 ENSP00000439403.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000543587.5Link to Ensembl Protein Viewer:ENSP00000439403.1Re-query CCDS DB by Nucleotide ID:ENST00000543587Re-query CCDS DB by Protein ID:ENSP00000439403
Original member Current member EBI ENST00000545680.5 ENSP00000443645.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000545680.5Link to Ensembl Protein Viewer:ENSP00000443645.1Re-query CCDS DB by Nucleotide ID:ENST00000545680Re-query CCDS DB by Protein ID:ENSP00000443645
Original member NCBI NM_001278485.1 NP_001265414.1 Updated not alive Link to Nucleotide Sequence:NM_001278485.1Link to Protein Sequence:NP_001265414.1Re-query CCDS DB by Nucleotide ID:NM_001278485Re-query CCDS DB by Protein ID:NP_001265414
Current member NCBI NM_001278485.2 NP_001265414.1 Accepted alive Link to Nucleotide Sequence:NM_001278485.2Link to Protein Sequence:NP_001265414.1Re-query CCDS DB by Nucleotide ID:NM_001278485Re-query CCDS DB by Protein ID:NP_001265414Link to BLAST:NP_001265414.1
Original member NCBI NM_001278486.1 NP_001265415.1 Updated not alive Link to Nucleotide Sequence:NM_001278486.1Link to Protein Sequence:NP_001265415.1Re-query CCDS DB by Nucleotide ID:NM_001278486Re-query CCDS DB by Protein ID:NP_001265415
Current member NCBI NM_001278486.2 NP_001265415.1 Accepted alive Link to Nucleotide Sequence:NM_001278486.2Link to Protein Sequence:NP_001265415.1Re-query CCDS DB by Nucleotide ID:NM_001278486Re-query CCDS DB by Protein ID:NP_001265415Link to BLAST:NP_001265415.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001265414.1 125 P60006-2 125 100% 0 0
NP_001265415.1 125 P60006-2 125 100% 0 0

Chromosomal Locations for CCDS 60880.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 11 (NC_000011.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 72109881 72109940 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72110088 72110225 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72110544 72110603 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11
11 72111157 72111276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (378 nt):
ATGTCCACTTTGTTCCCCTCACTCTTCCCTCGTGTGACTGAGACTCTGTGGTTTAATCTGGATCGACCCT
GT
GTGGAAGAGACAGAGCTGCAGCAGCAGGAACAGCAGCATCAGGCCTGGCTCCAAAGCATCGCGGAGAA
A
GACAACAACCTGGTTCCTATTGGCAAGCCAGCCTCAGAGCACTATGATGACGAGGAAGAAGAGGATGAT
GAA
GATGATGAGGATAGTGAAGAGGACTCAGAGGATGATGAGGATATGCAGGACATGGACGAGATGAATG
AC
TACAATGAGTCACCGGATGATGGAGAGGTCAATGAGCCTCCTCTCCAGGTGGACATGGAAGGCAACGA
A
CAGGATCAGGACCAGTGGATGATCTAG


Translation (125 aa):
MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDD
E
DDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNE
PPLQVDMEGNEQDQDQWMI



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser