NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6087.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6087.1 Public Homo sapiens 8 NRG1 22 109 92 CCDS HistoryNCBI Gene:3084Re-query CCDS DB by CCDS ID:6087.1Re-query CCDS DB by GeneID:3084See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6087.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000520502.6 ENSP00000433289.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000520502.6Link to Ensembl Protein Viewer:ENSP00000433289.1Re-query CCDS DB by Nucleotide ID:ENST00000520502Re-query CCDS DB by Protein ID:ENSP00000433289
Original member NCBI NM_013959.3 NP_039253.1 Updated not alive Link to Nucleotide Sequence:NM_013959.3Link to Protein Sequence:NP_039253.1Re-query CCDS DB by Nucleotide ID:NM_013959Re-query CCDS DB by Protein ID:NP_039253
Current member NCBI NM_013959.4 NP_039253.1 Accepted alive Link to Nucleotide Sequence:NM_013959.4Link to Protein Sequence:NP_039253.1Re-query CCDS DB by Nucleotide ID:NM_013959Re-query CCDS DB by Protein ID:NP_039253Link to BLAST:NP_039253.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_039253.1 296 Q02297-10 296 100% 0 0

Chromosomal Locations for CCDS 6087.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 32647718 32648384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32727949 32728078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32742675 32742768 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (891 nt):
ATGGAGATTTATTCCCCAGACATGTCTGAGGTCGCCGCCGAGAGGTCCTCCAGCCCCTCCACTCAGCTGA
GT
GCAGACCCATCTCTTGATGGGCTTCCGGCAGCAGAAGACATGCCAGAGCCCCAGACTGAAGATGGGAG
A
ACCCCTGGACTCGTGGGCCTGGCCGTGCCCTGCTGTGCGTGCCTAGAAGCTGAGCGCCTGAGAGGTTGC
CTC
AACTCAGAGAAAATCTGCATTGTCCCCATCCTGGCTTGCCTGGTCAGCCTCTGCCTCTGCATCGCCG
GC
CTCAAGTGGGTATTTGTGGACAAGATCTTTGAATATGACTCTCCTACTCACCTTGACCCTGGGGGGTT
A
GGCCAGGACCCTATTATTTCTCTGGACGCAACTGCTGCCTCAGCTGTGTGGGTGTCGTCTGAGGCATAC
ACT
TCACCTGTCTCTAGGGCTCAATCTGAAAGTGAGGTTCAAGTTACAGTGCAAGGTGACAAGGCTGTTG
TC
TCCTTTGAACCATCAGCGGCACCGACACCGAAGAATCGTATTTTTGCCTTTTCTTTCTTGCCGTCCAC
T
GCGCCATCCTTCCCTTCACCCACCCGGAACCCTGAGGTGAGAACGCCCAAGTCAGCAACTCAGCCACAA
ACA
ACAGAAACTAATCTCCAAACTGCTCCTAAACTTTCTACATCTACATCCACCACTGGGACAAGCCATC
TT
GTAAAATGTGCGGAGAAGGAGAAAACTTTCTGTGTGAATGGAGGGGAGTGCTTCATGGTGAAAGACCT
T
TCAAACCCCTCGAGATACTTGTGCAAGTGCCCAAATGAGTTTACTGGTGATCGCTGCCAAAACTACGTA
ATG
GCCAGCTTCTACAGTACGTCCACTCCCTTTCTGTCTCTGCCTGAATAG


Translation (296 aa):
MEIYSPDMSEVAAERSSSPSTQLSADPSLDGLPAAEDMPEPQTEDGRTPGLVGLAVPCCACLEAERLRGC
L
NSEKICIVPILACLVSLCLCIAGLKWVFVDKIFEYDSPTHLDPGGLGQDPIISLDATAASAVWVSSEAY
T
SPVSRAQSESEVQVTVQGDKAVVSFEPSAAPTPKNRIFAFSFLPSTAPSFPSPTRNPEVRTPKSATQPQ
T
TETNLQTAPKL
STSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYV
M
ASFYSTSTPFLSLPE




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser