NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS6085.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
6085.1 Public Homo sapiens 8 NRG1 22 109 92 CCDS HistoryNCBI Gene:3084Re-query CCDS DB by CCDS ID:6085.1Re-query CCDS DB by GeneID:3084See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 6085.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000405005.7 ENSP00000384620.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000405005.7Link to Ensembl Protein Viewer:ENSP00000384620.2Re-query CCDS DB by Nucleotide ID:ENST00000405005Re-query CCDS DB by Protein ID:ENSP00000384620
Original member NCBI NM_013964.4 NP_039258.1 Updated not alive Link to Nucleotide Sequence:NM_013964.4Link to Protein Sequence:NP_039258.1Re-query CCDS DB by Nucleotide ID:NM_013964Re-query CCDS DB by Protein ID:NP_039258
Current member NCBI NM_013964.5 NP_039258.1 Accepted alive Link to Nucleotide Sequence:NM_013964.5Link to Protein Sequence:NP_039258.1Re-query CCDS DB by Nucleotide ID:NM_013964Re-query CCDS DB by Protein ID:NP_039258Link to BLAST:NP_039258.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_039258.1 640 Q02297-1 640 100% 0 0

Chromosomal Locations for CCDS 6085.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 32548727 32548826 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32595828 32596005 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32605562 32605683 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32614514 32614564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32616835 32616885 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32727949 32728078 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32742008 32742075 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32754372 32754474 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32756403 32756529 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32759306 32759436 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32760200 32760406 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 32763748 32764402 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1923 nt):
ATGTCCGAGCGCAAAGAAGGCAGAGGCAAAGGGAAGGGCAAGAAGAAGGAGCGAGGCTCCGGCAAGAAGC
CG
GAGTCCGCGGCGGGCAGCCAGAGCCCAGCCTTGCCTCCCCGATTGAAAGAGATGAAAAGCCAGGAATC
G
GCTGCAGGTTCCAAACTAGTCCTTCGGTGTGAAACCAGTTCTGAATACTCCTCTCTCAGATTCAAGTGG
TTC
AAGAATGGGAATGAATTGAATCGAAAAAACAAACCACAAAATATCAAGATACAAAAAAAGCCAGGGA
AG
TCAGAACTTCGCATTAACAAAGCATCACTGGCTGATTCTGGAGAGTATATGTGCAAAGTGATCAGCAA
A
TTAGGAAATGACAGTGCCTCTGCCAATATCACCATCGTGGAATCAAACGAGATCATCACTGGTATGCCA
GCC
TCAACTGAAGGAGCATATGTGTCTTCAGAGTCTCCCATTAGAATATCAGTATCCACAGAAGGAGCAA
AT
ACTTCTTCATCTACATCTACATCCACCACTGGGACAAGCCATCTTGTAAAATGTGCGGAGAAGGAGAA
A
ACTTTCTGTGTGAATGGAGGGGAGTGCTTCATGGTGAAAGACCTTTCAAACCCCTCGAGATACTTGTGC
AA
G
TGCCAACCTGGATTCACTGGAGCAAGATGTACTGAGAATGTGCCCATGAAAGTCCAAAACCAAGAAA
AG
GCGGAGGAGCTGTACCAGAAGAGAGTGCTGACCATAACCGGCATCTGCATCGCCCTCCTTGTGGTCGG
C
ATCATGTGTGTGGTGGCCTACTGCAAAACCAAGAAACAGCGGAAAAAGCTGCATGACCGTCTTCGGCAG
AGC
CTTCGGTCTGAACGAAACAATATGATGAACATTGCCAATGGGCCTCACCATCCTAACCCACCCCCCG
AG
AATGTCCAGCTGGTGAATCAATACGTATCTAAAAACGTCATCTCCAGTGAGCATATTGTTGAGAGAGA
A
GCAGAGACATCCTTTTCCACCAGTCACTATACTTCCACAGCCCATCACTCCACTACTGTCACCCAGACT
CCT
AGCCACAGCTGGAGCAACGGACACACTGAAAGCATCCTTTCCGAAAGCCACTCTGTAATCGTGATGT
CA
TCCGTAGAAAACAGTAGGCACAGCAGCCCAACTGGGGGCCCAAGAGGACGTCTTAATGGCACAGGAGG
C
CCTCGTGAATGTAACAGCTTCCTCAGGCATGCCAGAGAAACCCCTGATTCCTACCGAGACTCTCCTCAT
AGT
GAAAGGTATGTGTCAGCCATGACCACCCCGGCTCGTATGTCACCTGTAGATTTCCACACGCCAAGCT
CC
CCCAAATCGCCCCCTTCGGAAATGTCTCCACCCGTGTCCAGCATGACGGTGTCCATGCCTTCCATGGC
G
GTCAGCCCCTTCATGGAAGAAGAGAGACCTCTACTTCTCGTGACACCACCAAGGCTGCGGGAGAAGAAG
TTT
GACCATCACCCTCAGCAGTTCAGCTCCTTCCACCACAACCCCGCGCATGACAGTAACAGCCTCCCTG
CT
AGCCCCTTGAGGATAGTGGAGGATGAGGAGTATGAAACGACCCAAGAGTACGAGCCAGCCCAAGAGCC
T
GTTAAGAAACTCGCCAATAGCCGGCGGGCCAAAAGAACCAAGCCCAATGGCCACATTGCTAACAGATTG
GAA
GTGGACAGCAACACAAGCTCCCAGAGCAGTAACTCAGAGAGTGAAACAGAAGATGAAAGAGTAGGTG
AA
GATACGCCTTTCCTGGGCATACAGAACCCCCTGGCAGCCAGTCTTGAGGCAACACCTGCCTTCCGCCT
G
GCTGACAGCAGGACTAACCCAGCAGGCCGCTTCTCGACACAGGAAGAAATCCAGGCCAGGCTGTCTAGT
GTA
ATTGCTAACCAAGACCCTATTGCTGTATAA


Translation (640 aa):
MSERKEGRGKGKGKKKERGSGKKPESAAGSQSPALPPRLKEMKSQESAAGSKLVLRCETSSEYSSLRFKW
F
KNGNELNRKNKPQNIKIQKKP
GKSELRINKASLADSGEYMCKVISKLGNDSASANITIVESNEIITGMP
A
STEGAYVSS
ESPIRISVSTEGANTSSSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLC
K
CQPGFTGARCTENVPMKVQNQEKAEELYQKRVLTITGICIALLVVGIMCVVAYCKTKKQRKKLHDRLRQ
S
LRSERNNMMNIANGPHHPNPPPENVQLVN
QYVSKNVISSEHIVEREAETSFSTSHYTSTAHHSTTVTQT
P
SH
SWSNGHTESILSESHSVIVMSSVENSRHSSPTGGPRGRLNGTGGPRECNSFLRHARETPDSYRDSPH
S
E
RYVSAMTTPARMSPVDFHTPSSPKSPPSEMSPPVSSMTVSMPSMAVSPFMEEERPLLLVTPPRLREKK
F
DHHPQQFSSFHHNPAHDSNSLPASPLRIVEDEEYETTQEYEPAQEPVKKLANSRRAKRTKPNGHIANRL
E
VDSNTSSQSSNSESETEDERVGEDTPFLGIQNPLAASLEATPAFRLADSRTNPAGRFSTQEEIQARLSS
V
IANQDPIAV




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser