NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS5981.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
5981.1 Public Homo sapiens 8 FAM167A 22 109 92 CCDS HistoryNCBI Gene:83648Re-query CCDS DB by CCDS ID:5981.1Re-query CCDS DB by GeneID:83648See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 5981.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000284486.8 ENSP00000284486.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000284486.8Link to Ensembl Protein Viewer:ENSP00000284486.4Re-query CCDS DB by Nucleotide ID:ENST00000284486Re-query CCDS DB by Protein ID:ENSP00000284486
Original member Current member EBI ENST00000534308.1 ENSP00000432232.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000534308.1Link to Ensembl Protein Viewer:ENSP00000432232.1Re-query CCDS DB by Nucleotide ID:ENST00000534308Re-query CCDS DB by Protein ID:ENSP00000432232
Original member Current member EBI ENST00000528897.1 ENSP00000436655.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000528897.1Link to Ensembl Protein Viewer:ENSP00000436655.1Re-query CCDS DB by Nucleotide ID:ENST00000528897Re-query CCDS DB by Protein ID:ENSP00000436655
Original member NCBI NM_053279.2 NP_444509.2 Updated not alive Link to Nucleotide Sequence:NM_053279.2Link to Protein Sequence:NP_444509.2Re-query CCDS DB by Nucleotide ID:NM_053279Re-query CCDS DB by Protein ID:NP_444509
Current member NCBI NM_053279.3 NP_444509.2 Accepted alive Link to Nucleotide Sequence:NM_053279.3Link to Protein Sequence:NP_444509.2Re-query CCDS DB by Nucleotide ID:NM_053279Re-query CCDS DB by Protein ID:NP_444509Link to BLAST:NP_444509.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_444509.2 214 Q96KS9 214 100% 0 0

Chromosomal Locations for CCDS 5981.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 11424373 11424636 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 11444031 11444411 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (645 nt):
ATGTCTGTGCCCCAGATCCACGTGGAAGAAGTGGGTGCAGAAGAGGGGGCGGGAGCAGCCGCACCACCCG
AT
GACCACCTCCGGAGCCTGAAGGCCCTCACCGAGAAACTGAGGCTGGAGACCCGCAGGCCCTCCTACCT
G
GAATGGCAGGCCAGGCTGGAGGAGCATACCTGGCCCTTCCCGAGGCCGGCTGCGGAGCCACAGGCGAGC
TTG
GAGGAGGGGGAGCGTGGGGGGCAGGAGCCCTTGCTCCCCCTGAGAGAGGCTGGGCAGCACCCCCCTT
CT
GCCAGGAGTGCCAGCCAAGGTGCCAGACCCCTGTCCACTGGCAAGCTGGAAGGCTTTCAGAGCATCGA
T
GAAGCTATAGCCTGGCTCAGGAAGGAACTGACGGAGATGCGGCTGCAGGACCAGCAACTGGCCAGACAG
CTC
ATGCGCCTGCGTGGCGACATCAACAAGCTGAAAATCGAACACACCTGCCGCCTCCACAGGAGGATGC
TC
AACGATGCCACCTACGAGCTGGAGGAGCGGGATGAGCTGGCCGACCTCTTCTGTGACTCCCCTCTTGC
C
TCCTCCTTCAGCCTCTCCACACCACTCAAGCTTATTGGCGTGACCAAGATGAACATCAACTCTCGGAGG
TTC
TCTCTCTGCTGA


Translation (214 aa):
MSVPQIHVEEVGAEEGAGAAAPPDDHLRSLKALTEKLRLETRRPSYLEWQARLEEHTWPFPRPAAEPQAS
L
EEGERGGQEPLLPLREAGQHPPSARSASQGARPLSTGKLEGFQSIDEAIAWLRKEL
TEMRLQDQQLARQ
L
MRLRGDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTPLKLIGVTKMNINSRR
F
SLC




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser