NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS59408.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
59408.1 Public Homo sapiens 19 IRF3 22 109 92 CCDS HistoryNCBI Gene:3661Re-query CCDS DB by CCDS ID:59408.1Re-query CCDS DB by GeneID:3661See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 12, NCBI annotation release 104, Ensembl annotation release 71

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 59408.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000377135.8 ENSP00000366339.5 Accepted alive Link to Ensembl Transcript Viewer:ENST00000377135.8Link to Ensembl Protein Viewer:ENSP00000366339.5Re-query CCDS DB by Nucleotide ID:ENST00000377135Re-query CCDS DB by Protein ID:ENSP00000366339
Original member Current member EBI ENST00000599144.5 ENSP00000470069.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000599144.5Link to Ensembl Protein Viewer:ENSP00000470069.1Re-query CCDS DB by Nucleotide ID:ENST00000599144Re-query CCDS DB by Protein ID:ENSP00000470069
Original member Current member EBI ENST00000598808.5 ENSP00000472582.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000598808.5Link to Ensembl Protein Viewer:ENSP00000472582.1Re-query CCDS DB by Nucleotide ID:ENST00000598808Re-query CCDS DB by Protein ID:ENSP00000472582
Original member Current member EBI ENST00000593922.5 ENSP00000472601.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000593922.5Link to Ensembl Protein Viewer:ENSP00000472601.1Re-query CCDS DB by Nucleotide ID:ENST00000593922Re-query CCDS DB by Protein ID:ENSP00000472601
Original member NCBI NM_001197125.1 NP_001184054.1 Updated not alive Link to Nucleotide Sequence:NM_001197125.1Link to Protein Sequence:NP_001184054.1Re-query CCDS DB by Nucleotide ID:NM_001197125Re-query CCDS DB by Protein ID:NP_001184054
Current member NCBI NM_001197125.2 NP_001184054.1 Accepted alive Link to Nucleotide Sequence:NM_001197125.2Link to Protein Sequence:NP_001184054.1Re-query CCDS DB by Nucleotide ID:NM_001197125Re-query CCDS DB by Protein ID:NP_001184054Link to BLAST:NP_001184054.1
Original member NCBI NM_001197126.1 NP_001184055.1 Updated not alive Link to Nucleotide Sequence:NM_001197126.1Link to Protein Sequence:NP_001184055.1Re-query CCDS DB by Nucleotide ID:NM_001197126Re-query CCDS DB by Protein ID:NP_001184055
Current member NCBI NM_001197126.2 NP_001184055.1 Accepted alive Link to Nucleotide Sequence:NM_001197126.2Link to Protein Sequence:NP_001184055.1Re-query CCDS DB by Nucleotide ID:NM_001197126Re-query CCDS DB by Protein ID:NP_001184055Link to BLAST:NP_001184055.1

Chromosomal Locations for CCDS 59408.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 49659648 49659833 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49660713 49660828 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49661948 49662328 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 49662425 49662587 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (846 nt):
ATGGTGTTGGCCCCACTCCCAGATCCGGGACCCCCAAGCCTGGCTGTAGCCCCTGAGCCCTGCCCTCAGC
CC
CTGCGGAGCCCCAGCTTGGACAATCCCACTCCCTTCCCAAACCTGGGGCCCTCTGAGAACCCACTGAA
G
CGGCTGTTGGTGCCGGGGGAAGAGTGGGAGTTCGAGGTGACAGCCTTCTACCGGGGCCGCCAAGTCTTC
CAG
CAGACCATCTCCTGCCCGGAGGGCCTGCGGCTGGTGGGGTCCGAAGTGGGAGACAGGACGCTGCCTG
GA
TGGCCAGTCACACTGCCAGACCCTGGCATGTCCCTGACAGACAGGGGAGTGATGAGCTACGTGAGGCA
T
GTGCTGAGCTGCCTGGGTGGGGGACTGGCTCTCTGGCGGGCCGGGCAGTGGCTCTGGGCCCAGCGGCTG
GGG
CACTGCCACACATACTGGGCAGTGAGCGAGGAGCTGCTCCCCAACAGCGGGCATGGGCCTGATGGCG
AG
GTCCCCAAGGACAAGGAAGGAGGCGTGTTTGACCTGGGGCCCTTCATTGTAGATCTGATTACCTTCAC
G
GAAGGAAGCGGACGCTCACCACGCTATGCCCTCTGGTTCTGTGTGGGGGAGTCATGGCCCCAGGACCAG
CCG
TGGACCAAGAGGCTCGTGATGGTCAAGGTTGTGCCCACGTGCCTCAGGGCCTTGGTAGAAATGGCCC
GG
GTAGGGGGTGCCTCCTCCCTGGAGAATACTGTGGACCTGCACATTTCCAACAGCCACCCACTCTCCCT
C
ACCTCCGACCAGTACAAGGCCTACCTGCAGGACTTGGTGGAGGGCATGGATTTCCAGGGCCCTGGGGAG
AGC
TGA


Translation (281 aa):
MVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVF
Q
QTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRL
G
HCHTYWAVSEELLPNSGHGPDGEVPKDKEGGVFDLGPFIV
DLITFTEGSGRSPRYALWFCVGESWPQDQ
P
WTKRLVMVK
VVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMDFQGPGE
S




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser