NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS59401.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
59401.1 Public Homo sapiens 19 PRKD2 22 109 92 CCDS HistoryNCBI Gene:25865Re-query CCDS DB by CCDS ID:59401.1Re-query CCDS DB by GeneID:25865See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 12, NCBI annotation release 104, Ensembl annotation release 71

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 59401.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000601806.5 ENSP00000469106.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000601806.5Link to Ensembl Protein Viewer:ENSP00000469106.1Re-query CCDS DB by Nucleotide ID:ENST00000601806Re-query CCDS DB by Protein ID:ENSP00000469106
Original member Current member EBI ENST00000600194.5 ENSP00000472744.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000600194.5Link to Ensembl Protein Viewer:ENSP00000472744.1Re-query CCDS DB by Nucleotide ID:ENST00000600194Re-query CCDS DB by Protein ID:ENSP00000472744
Original member NCBI NM_001079882.1 NP_001073351.1 Updated not alive Link to Nucleotide Sequence:NM_001079882.1Link to Protein Sequence:NP_001073351.1Re-query CCDS DB by Nucleotide ID:NM_001079882Re-query CCDS DB by Protein ID:NP_001073351
Current member NCBI NM_001079882.2 NP_001073351.1 Accepted alive Link to Nucleotide Sequence:NM_001079882.2Link to Protein Sequence:NP_001073351.1Re-query CCDS DB by Nucleotide ID:NM_001079882Re-query CCDS DB by Protein ID:NP_001073351Link to BLAST:NP_001073351.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001073351.1 721 Q9BZL6-2 721 100% 0 0

Chromosomal Locations for CCDS 59401.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 46674523 46674735 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46675033 46675118 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46678396 46678663 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46681650 46681748 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46689537 46689698 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46690600 46690706 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46691735 46691807 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46691933 46691985 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46693875 46694133 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46697157 46697234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46697733 46697850 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46700799 46700952 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46701035 46701112 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46704169 46704391 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46704495 46704649 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 46710907 46710946 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2166 nt):
ATGCTCTTCGGCCTAGTGCGCCAGGGCCTCAAGTGCGATGGCTGCGGGCTGAACTACCACAAGCGCTGTG
CC
TTCAGCATCCCCAACAACTGTAGTGGGGCCCGCAAACGGCGCCTGTCATCCACGTCTCTGGCCAGTGG
C
CACTCGGTGCGCCTCGGCACCTCCGAGTCCCTGCCCTGCACGGCTGAAGAGCTGAGCCGTAGCACCACC
GAA
CTCCTGCCTCGCCGTCCCCCGTCATCCTCTTCCTCCTCTTCTGCCTCATCGTATACGGGCCGCCCCA
TT
GAGCTGGACAAGATGCTGCTCTCCAAGGTCAAGGTGCCGCACACCTTCCTCATCCACAGCTATACACG
G
CCCACCGTTTGCCAGGCTTGCAAGAAACTCCTCAAGGGCCTCTTCCGGCAGGGCCTGCAATGCAAAGAC
TGC
AAGTTTAACTGTCACAAACGCTGCGCCACCCGCGTCCCTAATGACTGCCTGGGGGAGGCCCTTATCA
AT
GGAGATGTGCCGATGGAGGAGGCCACCGATTTCAGCGAGGCTGACAAGAGCGCCCTCATGGATGAGTC
A
GAGGACTCCGGTGTCATCCCTGGCTCCCACTCAGAGAATGCGCTCCACGCCAGTGAGGAGGAGGAAGGC
GAG
GGAGGCAAGGCCCAGAGCTCCCTGGGGTACATCCCCCTAATGAGGGTGGTGCAATCGGTGCGACACA
CG
ACGCGGAAATCCAGCACCACGCTGCGGGAGGGTTGGGTGGTTCATTACAGCAACAAGGACACGCTGAG
A
AAGCGGCACTATTGGCGCCTGGACTGCAAGTGTATCACGCTCTTCCAGAACAACACGACCAACAGATAC
TAT
AAGGAAATTCCGCTGTCAGAAATCCTCACGGTGGAGTCCGCCCAGAACTTCAGCCTTGTGCCGCCGG
GC
ACCAACCCACACTGCTTTGAGATCGTCACTGCCAATGCCACCTACTTCGTGGGCGAGATGCCTGGCGG
G
ACTCCGGGTGGGCCAAGTGGGCAGGGGGCTGAGGCCGCCCGGGGCTGGGAGACAGCCATCCGCCAGGCC
CTG
ATGCCCGTCATCCTTCAGGACGCACCCAGCGCCCCAGGCCACGCGCCCCACAGACAAGCTTCTCTGA
GC
ATCTCTGTGTCCAACAGTCAGATCCAAGAGAATGTGGACATTGCCACTGTCTACCAGATCTTCCCTGA
C
GAAGTGCTGGGCTCAGGGCAGTTTGGAGTGGTCTATGGAGGAAAACACCGGAAGACAGGCCGGGACGTG
GCA
GTTAAGGTCATTGACAAACTGCGCTTCCCTACCAAGCAGGAGAGCCAGCTCCGGAATGAAGTGGCCA
TT
CTGCAGAGCCTGCGGCATCCCGGGATCGTGAACCTGGAGTGCATGTTCGAGACGCCTGAGAAAGTGTT
T
GTGGTGATGGAGAAGCTGCATGGGGACATGTTGGAGATGATCCTGTCCAGTGAGAAGGGCCGGCTGCCT
GAG
CGCCTCACCAAGTTCCTCATCACCCAGATCCTGGTGGCTTTGAGACACCTTCACTTCAAGAACATTG
TC
CACTGTGACTTGAAACCAGAAAACGTGTTGCTGGCATCAGCAGACCCATTTCCTCAGGTGAAGCTGTG
T
GACTTTGGCTTTGCTCGCATCATCGGCGAGAAGTCGTTCCGCCGCTCAGTGGTGGGCACGCCGGCCTAC
CTG
GCACCCGAGGTGCTGCTCAACCAGGGCTACAACCGCTCGCTGGACATGTGGTCAGTGGGCGTGATCA
TG
TACGTCAGCCTCAGCGGCACCTTCCCTTTCAACGAGGATGAGGACATCAATGACCAGATCCAGAACGC
C
GCCTTCATGTACCCGGCCAGCCCCTGGAGCCACATCTCAGCTGGAGCCATTGACCTCATCAACAACCTG
CTG
CAGGTGAAGATGCGCAAACGCTACAGCGTGGACAAATCTCTCAGCCACCCCTGGTTACAGGAGTACC
AG
ACGTGGCTGGACCTCCGAGAGCTGGAGGGGAAGATGGGAGAGCGATACATCACGCATGAGAGTGACGA
C
GCGCGCTGGGAGCAGTTTGCAGCAGAGCATCCGCTGCCTGGGTCTGGGCTGCCCACGGACAGGGATCTC
GGT
GGGGCCTGTCCACCACAGGACCACGACATGCAGGGGCTGGCGGAGCGCATCAGTGTTCTCTGA


Translation (721 aa):
MLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTT
E
LLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCK
D
C
KFNCHKRCATRVPNDCLGEALING
DVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALHASEEEEG
E
GGKAQ
SSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRY
Y
K
EIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQA
L
MPVILQDAPSAPGHAPH
RQASLSISVSNSQIQENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDV
A
VKVIDKLRFPTKQESQLRNEVAILQ
SLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLP
E
RLTKFLITQ
ILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAY
L
APEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAG
AIDLINNL
L
QVKMRKRYSVDKSLSHPWLQ
EYQTWLDLRELEGKMGERYITHESDDARWEQFAAEHPLPGSGLPTDRDL
G
GACPPQDHDMQGLAERISVL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser