NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS59092.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
59092.1 Public Homo sapiens 8 FAM86B2 22 109 92 CCDS HistoryNCBI Gene:653333Re-query CCDS DB by CCDS ID:59092.1Re-query CCDS DB by GeneID:653333See the combined annotation on chromosome 8 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Provisional (this record has not been manually reviewed by the collaboration)


Attributes
Inferred exon combination

Sequence IDs included in CCDS 59092.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000262365.8 ENSP00000262365.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000262365.8Link to Ensembl Protein Viewer:ENSP00000262365.4Re-query CCDS DB by Nucleotide ID:ENST00000262365Re-query CCDS DB by Protein ID:ENSP00000262365
Original member Current member NCBI NM_001137610.2 NP_001131082.1 Accepted alive Link to Nucleotide Sequence:NM_001137610.2Link to Protein Sequence:NP_001131082.1Re-query CCDS DB by Nucleotide ID:NM_001137610Re-query CCDS DB by Protein ID:NP_001131082Link to BLAST:NP_001131082.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001131082.1 330 P0C5J1 330 100% 0 0

Chromosomal Locations for CCDS 59092.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 8 (NC_000008.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8See the combined annotation on chromosome 8 in Sequence Viewer

Chromosome Start Stop Links
8 12425889 12425989 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 12427657 12427806 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 12428633 12428898 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 12428981 12429114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 12430350 12430451 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 12432082 12432162 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 12434052 12434114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8
8 12436248 12436343 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 8Link to Ensembl Genome Browser on chromosome 8

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (993 nt):
ATGGCGCCCGAGGAGAACGCGGGGACCGAACTCTTGCTGCAGGGTTTTGAGCGCCGCTTCCTGGCGGTGC
GC
ACACTGCGCTCCTTCCCCTGGCAGAGCTTAGAGGCAAAGTTAAGAGACTCATCAGATTCTGAGCTGCT
G
CGGGATATTTTGCAGAAGACTGTGAGGCATCCTGTGTGTGTGAAGCACCCGCCGTCAGTCAAGTATGCC
TGG
TGCTTTCTCTCAGAACTCATCAAAAAGCACGAGGCTGTCCACACGGAGCCTTTGGACAAACTGTACG
AG
GTGCTCGCGGAGACTCTGATGGCCAAGGAGTCCACCCAGGGCCACCGGAGCTATTTGCTGTCCTCAGG
A
GGCTCAGTCACACTCTCCAAGAGCACAGCCATCATCTCCCACGGTACCACAGGCCTGGTCACATGGGAT
GCC
GCCCTCTACCTTGCAGAATGGGCCATCGAGAACCCGGCAGCCTTCATTAACAGGACTGTCCTAGAGC
TT
GGCAGTGGTGCCGGCCTCACAGGCCTTGCCATCTGCAAGATGTGCCGCCCCCGGGCATACATCTTCAG
C
GACCCTCACAGCCGGATCCTCGAGCAGCTCCGAGGGAATGTCCTTCTCAATGGCCTCTCATTAGAGGCA
GAC
ATCACTGGCAACTTAGACAGCCCCAGGGTGACAGTGGCCCAGCTGGACTGGGACGTAGCAATGGTCC
AT
CAGCTCTCTGCCTTCCAGCCAGATGTTGTCATTGCAGCAGACGTGCTGTATTGCCCAGAAGCCATCGT
G
TCGCTGGTCGGGGTCCTGCAGAGGCTGGCTGCCTGCCGGGAGCACAAGCGGGCTCCTGAGGTCTACGTG
GCC
TTTACCGTCCGCAACCCAGAGACATGCCAGCTGTTCACCACCGAGCTAGGCCGGGATGGGATCAGAT
GG
GAAGCGGAAGCTCATCATGACCAGAAACTGTTTCCCTATGGAGAGCACTTGGAGATGGCAATGCTGAA
C
CTCACACTGTAG


Translation (330 aa):
MAPEENAGTELLLQGFERRFLAVRTLRSFPWQSLEAKLRDSSDSELLRDILQKTVRHPVCVKHPPSVKYA
W
CFLSELIKK
HEAVHTEPLDKLYEVLAETLMAKESTQGHRSYLLSSGGSVTLSKSTAIISHGTTGLVTWD
A
ALYLAEWAIENPAAFIN
RTVLELGSGAGLTGLAICKMCRPRAYIFSDPHSRILEQLRGNVLLNGLSLEA
D
ITGNLDSPRVTVAQLDWDVAMVHQLSAFQPDVVIAA
DVLYCPEAIVSLVGVLQRLAACREHKRAPEVYV
A
FTVRNPETCQLFTTEL
GRDGIRWEAEAHHDQKLFPYGEHLEMAMLNLTL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser