NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS58965.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58965.1 Public Homo sapiens 5 SLC12A2 22 109 92 CCDS HistoryNCBI Gene:6558Re-query CCDS DB by CCDS ID:58965.1Re-query CCDS DB by GeneID:6558See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58965.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000343225.4 ENSP00000340878.4 Accepted alive Link to Ensembl Transcript Viewer:ENST00000343225.4Link to Ensembl Protein Viewer:ENSP00000340878.4Re-query CCDS DB by Nucleotide ID:ENST00000343225Re-query CCDS DB by Protein ID:ENSP00000340878
Original member NCBI NM_001256461.1 NP_001243390.1 Updated not alive Link to Nucleotide Sequence:NM_001256461.1Link to Protein Sequence:NP_001243390.1Re-query CCDS DB by Nucleotide ID:NM_001256461Re-query CCDS DB by Protein ID:NP_001243390
Current member NCBI NM_001256461.2 NP_001243390.1 Accepted alive Link to Nucleotide Sequence:NM_001256461.2Link to Protein Sequence:NP_001243390.1Re-query CCDS DB by Nucleotide ID:NM_001256461Re-query CCDS DB by Protein ID:NP_001243390Link to BLAST:NP_001243390.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001243390.1 1196 P55011-3 1196 100% 0 0

Chromosomal Locations for CCDS 58965.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '+' strand of Chromosome 5 (NC_000005.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 128083955 128084710 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128112814 128112933 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128114212 128114287 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128114586 128114681 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128131067 128131206 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128134165 128134275 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128135700 128135808 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128138597 128138724 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128138824 128138908 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128141830 128141981 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128147622 128147729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128148754 128148877 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128149997 128150098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128151241 128151396 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128152706 128152805 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128158053 128158164 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128161660 128161800 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128167761 128167867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128171667 128171746 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128174541 128174666 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128178567 128178689 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128180883 128180994 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128182855 128182941 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128184366 128184501 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128184789 128184856 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5
5 128186496 128186631 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3591 nt):
ATGGAGCCGCGGCCCACGGCGCCCTCCTCCGGCGCCCCGGGACTGGCCGGGGTCGGGGAGACGCCGTCAG
CC
GCTGCGCTGGCCGCAGCCAGGGTGGAACTGCCCGGCACGGCTGTGCCCTCGGTGCCGGAGGATGCTGC
G
CCCGCGAGCCGGGACGGCGGCGGGGTCCGCGATGAGGGCCCCGCGGCGGCCGGGGACGGGCTGGGCAGA
CCC
TTGGGGCCCACCCCGAGCCAGAGCCGTTTCCAGGTGGACCTGGTTTCCGAGAACGCCGGGCGGGCCG
CT
GCTGCGGCGGCGGCGGCGGCGGCGGCAGCGGCGGCGGCTGGTGCTGGGGCGGGGGCCAAGCAGACCCC
C
GCGGACGGGGAAGCCAGCGGCGAGAGCGAGCCGGCTAAAGGCAGCGAGGAAGCCAAGGGCCGCTTCCGC
GTG
AACTTCGTGGACCCAGCTGCCTCCTCGTCGGCTGAAGACAGCCTGTCAGATGCTGCCGGGGTCGGAG
TC
GACGGGCCCAACGTGAGCTTCCAGAACGGCGGGGACACGGTGCTGAGCGAGGGCAGCAGCCTGCACTC
C
GGCGGCGGCGGCGGCAGTGGGCACCACCAGCACTACTATTATGATACCCACACCAACACCTACTACCTG
CGC
ACCTTCGGCCACAACACCATGGACGCTGTGCCCAGGATCGATCACTACCGGCACACAGCCGCGCAGC
TG
GGCGAGAAGCTGCTCCGGCCTAGCCTGGCGGAGCTCCACGACGAGCTGGAAAAGGAACCTTTTGAGGA
T
GGCTTTGCAAATGGGGAAGAAAGTACTCCAACCAGAGATGCTGTGGTCACGTATACTGCAGAAAGTAAA
GGA
GTCGTGAAGTTTGGCTGGATCAAGGGTGTATTAGTACGTTGTATGTTAAACATTTGGGGTGTGATGC
TT
TTCATTAGATTGTCATGGATTGTGGGTCAAGCTGGAATAGGTCTATCAGTCCTTGTAATAATGATGGC
C
ACTGTTGTGACAACTATCACAGGATTGTCTACTTCAGCAATAGCAACTAATGGATTTGTAAGAGGAGGA
GGA
GCATATTATTTAATATCTAGAAGTCTAGGGCCAGAATTTGGTGGTGCAATTGGTCTAATCTTCGCCT
TT
GCCAACGCTGTTGCAGTTGCTATGTATGTGGTTGGATTTGCAGAAACCGTGGTGGAGTTGCTTAAGGA
A
CATTCCATACTTATGATAGATGAAATCAATGATATCCGAATTATTGGAGCCATTACAGTCGTGATTCTT
TTA
GGTATCTCAGTAGCTGGAATGGAGTGGGAAGCAAAAGCTCAGATTGTTCTTTTGGTGATCCTACTTC
TT
GCTATTGGTGATTTCGTCATAGGAACATTTATCCCACTGGAGAGCAAGAAGCCAAAAGGGTTTTTTGG
T
TATAAATCTGAAATATTTAATGAGAACTTTGGGCCCGATTTTCGAGAGGAAGAGACTTTCTTTTCTGTA
TTT
GCCATCTTTTTTCCTGCTGCAACTGGTATTCTGGCTGGAGCAAATATCTCAGGTGATCTTGCAGATC
CT
CAGTCAGCCATACCCAAAGGAACACTCCTAGCCATTTTAATTACTACATTGGTTTACGTAGGAATTGC
A
GTATCTGTAGGTTCTTGTGTTGTTCGAGATGCCACTGGAAACGTTAATGACACTATCGTAACAGAGCTA
ACA
AACTGTACTTCTGCAGCCTGCAAATTAAACTTTGATTTTTCATCTTGTGAAAGCAGTCCTTGTTCCT
AT
GGCCTAATGAACAACTTCCAGGTAATGAGTATGGTGTCAGGATTTACACCACTAATTTCTGCAGGTAT
A
TTTTCAGCCACTCTTTCTTCAGCATTAGCATCCCTAGTGAGTGCTCCCAAAATATTTCAGGCTCTATGT
AAG
GACAACATCTACCCAGCTTTCCAGATGTTTGCTAAAGGTTATGGGAAAAATAATGAACCTCTTCGTG
GC
TACATCTTAACATTCTTAATTGCACTTGGATTCATCTTAATTGCTGAACTGAATGTTATTGCACCAAT
T
ATCTCAAACTTCTTCCTTGCATCATATGCATTGATCAATTTTTCAGTATTCCATGCATCACTTGCAAAA
TCT
CCAGGATGGCGTCCTGCATTCAAATACTACAACATGTGGATATCACTTCTTGGAGCAATTCTTTGTT
GC
ATAGTAATGTTCGTCATTAACTGGTGGGCTGCATTGCTAACATATGTGATAGTCCTTGGGCTGTATAT
T
TATGTTACCTACAAAAAACCAGATGTGAATTGGGGATCCTCTACACAAGCCCTGACTTACCTGAATGCA
CTG
CAGCATTCAATTCGTCTTTCTGGAGTGGAAGACCACGTGAAAAACTTTAGGCCACAGTGTCTTGTTA
TG
ACAGGTGCTCCAAACTCACGTCCAGCTTTACTTCATCTTGTTCATGATTTCACAAAAAATGTTGGTTT
G
ATGATCTGTGGCCATGTACATATGGGTCCTCGAAGACAAGCCATGAAAGAGATGTCCATCGATCAAGCC
AAA
TATCAGCGATGGCTTATTAAGAACAAAATGAAGGCATTTTATGCTCCAGTACATGCAGATGACTTGA
GA
GAAGGTGCACAGTATTTGATGCAGGCTGCTGGTCTTGGTCGTATGAAGCCAAACACACTTGTCCTTGG
A
TTTAAGAAAGATTGGTTGCAAGCAGATATGAGGGATGTGGATATGTATATAAACTTATTTCATGATGCT
TTT
GACATACAATATGGAGTAGTGGTTATTCGCCTAAAAGAAGGTCTGGATATATCTCATCTTCAAGGAC
AA
GAAGAATTATTGTCATCACAAGAGAAATCTCCTGGCACCAAGGATGTGGTAGTAAGTGTGGAATATAG
T
AAAAAGTCCGATTTAGATACTTCCAAACCACTCAGTGAAAAACCAATTACACACAAAGAATCCAAAGGC
CCT
ATTGTGCCTTTAAATGTAGCTGACCAAAAGCTTCTTGAAGCTAGTACACAGTTTCAGAAAAAACAAG
GA
AAGAATACTATTGATGTCTGGTGGCTTTTTGATGATGGAGGTTTGACCTTATTGATACCTTACCTTCT
G
ACGACCAAGAAAAAATGGAAAGACTGTAAGATCAGAGTATTCATTGGTGGAAAGATAAACAGAATAGAC
CAT
GACCGGAGAGCGATGGCTACTTTGCTTAGCAAGTTCCGGATAGACTTTTCTGATATCATGGTTCTAG
GA
GATATCAATACCAAACCAAAGAAAGAAAATATTATAGCTTTTGAGGAAATCATTGAGCCATACAGACT
T
CATGAAGATGATAAAGAGCAAGATATTGCAGATAAAATGAAAGAAGATGAACCATGGCGAATAACAGAT
AAT
GAGCTTGAACTTTATAAGACCAAGACATACCGGCAGATCAGGTTAAATGAGTTATTAAAGGAACATT
CA
AGCACAGCTAATATTATTGTCATGAGTCTCCCAGTTGCACGAAAAGGTGCTGTGTCTAGTGCTCTCTA
C
ATGGCATGGTTAGAAGCTCTATCTAAGGACCTACCACCAATCCTCCTAGTTCGTGGGAATCATCAGAGT
GTC
CTTACCTTCTATTCATAA


Translation (1196 aa):
MEPRPTAPSSGAPGLAGVGETPSAAALAAARVELPGTAVPSVPEDAAPASRDGGGVRDEGPAAAGDGLGR
P
LGPTPSQSRFQVDLVSENAGRAAAAAAAAAAAAAAAGAGAGAKQTPADGEASGESEPAKGSEEAKGRFR
V
NFVDPAASSSAEDSLSDAAGVGVDGPNVSFQNGGDTVLSEGSSLHSGGGGGSGHHQHYYYDTHTNTYYL
R
TFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELHDELEK
EPFEDGFANGEESTPTRDAVVTYTAESK
G
VVKFGWIKGVL
VRCMLNIWGVMLFIRLSWIVGQAGIGLSVLVIMMATVVTTITGLSTSAIATNGFVRGG
G
AYYLISRSLGPEFGGAIGLIFAFANAVAVAMYVVGFAETVVELLK
EHSILMIDEINDIRIIGAITVVIL
L
GISVAGMEWEAK
AQIVLLVILLLAIGDFVIGTFIPLESKKPKGFFGYKSEIFNENFGPDFREEETFFSV
F
AIFFPAATGILAGANISGDLA
DPQSAIPKGTLLAILITTLVYVGIAVSVGSCVVRDATGNVNDTIVTEL
T
NCTSAACKLNFDFSSCESSPCSYGLMNNFQ
VMSMVSGFTPLISAGIFSATLSSALASLVSAPKIFQALC
K
DNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFILI
AELNVIAPIISNFFLASYALINFSVFHASLAK
S
P
GWRPAFKYYNMWISLLGAILCCIVMFVINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNA
L
QHSIRLSGVEDHVKNF
RPQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQA
K
YQRWLIKNKMKAFYAPVHADDLREGAQYLMQ
AAGLGRMKPNTLVLGFKKDWLQADMRDVDMYINLFHDA
F
DIQYGVVVIRLKEGLDISHLQGQ
EELLSSQEKSPGTKDVVVSVEYSKKSDLDTSKPLSEKPITHKESKG
P
IVPLNVADQKLLEASTQFQKKQGKNTIDVWWLFDDG
GLTLLIPYLLTTKKKWKDCKIRVFIGGKINRID
H
DRR
AMATLLSKFRIDFSDIMVLGDINTKPKKENIIAFEEIIEPYRLHEDDKEQDIADKMKEDEPWRITD
N
ELELYKTK
TYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPILLVRGNHQS
V
LTFYS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser