NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS58577.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58577.1 Public Homo sapiens 17 SPAG9 22 109 92 CCDS HistoryNCBI Gene:9043Re-query CCDS DB by CCDS ID:58577.1Re-query CCDS DB by GeneID:9043See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58577.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000510283.5 ENSP00000423165.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000510283.5Link to Ensembl Protein Viewer:ENSP00000423165.1Re-query CCDS DB by Nucleotide ID:ENST00000510283Re-query CCDS DB by Protein ID:ENSP00000423165
Original member NCBI NM_001251971.1 NP_001238900.1 Updated not alive Link to Nucleotide Sequence:NM_001251971.1Link to Protein Sequence:NP_001238900.1Re-query CCDS DB by Nucleotide ID:NM_001251971Re-query CCDS DB by Protein ID:NP_001238900
Current member NCBI NM_001251971.2 NP_001238900.1 Accepted alive Link to Nucleotide Sequence:NM_001251971.2Link to Protein Sequence:NP_001238900.1Re-query CCDS DB by Nucleotide ID:NM_001251971Re-query CCDS DB by Protein ID:NP_001238900Link to BLAST:NP_001238900.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001238900.1 1177 O60271-9 1177 100% 0 0

Chromosomal Locations for CCDS 58577.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 17 (NC_000017.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 50966272 50966387 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50970707 50970856 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50974771 50974947 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50975863 50975901 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50977108 50977221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50979746 50979917 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50982524 50982672 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50984923 50984990 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50985698 50985778 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50987112 50987237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50989677 50989872 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50990450 50990668 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50993764 50993935 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50995057 50995224 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50995444 50995533 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50996565 50996694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50998444 50998617 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 50999661 50999717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51001715 51001845 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51005212 51005263 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51006085 51006237 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51007269 51007326 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51014232 51014353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51020159 51020258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51021158 51021365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51041501 51041651 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 51046500 51046660 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3534 nt):
ATGAGTCCTGGATGCATGCTGCTGTTTGTGTTTGGCTTTGTTGGCGGGGCGGTGGTCATTAATTCTGCTA
TC
TTAGTATCTCTCTCTGTTTTGCTGCTTGTGCACTTTTCTATTTCTACCGGTGTGCCAGCTCTGACGCA
G
AACCTACCAAGGATACTCAGAAAAGAACGCCCTATATCATTAGGAATTTTCCCATTACCTGCTGGAGAT
GGA
TTGCTTACACCTGATGCTCAGAAAGGAGGAGAGACCCCTGGATCTGAGCAATGGAAATTTCAGGAAT
TA
AGTCAACCACGTTCTCATACCAGCCTGAAGGATGAGCTTTCTGATGTTAGCCAAGGCGGATCTAAAGC
T
ACCACTCCAGCATCAACAGCTAATTCAGATGTGGCAACAATTCCTACTGATACTCCCTTAAAGGAAGAA
AAC
GAAGGATTTGTGAAGGTTACAGATGCGCCAAATAAATCAGAGATAAGCAAACACATTGAAGTACAGG
TA
GCCCAGGAAACTAGAAATGTATCTACTGGCTCTGCTGAAAATGAAGAAAAGTCAGAAGTTCAAGCAAT
C
ATCGAATCTACTCCTGAGCTGGATATGGACAAAGATCTCAGTGGATATAAAGGTTCAAGCACTCCCACC
AAA
GGCATAGAGAACAAAGCTTTTGATCGCAATACAGAATCTCTCTTTGAAGAACTGTCTTCAGCTGGCT
CA
GGCCTAATAGGAGATGTGGATGAAGGAGCAGATTTACTAGGAATGGGTCGGGAAGTTGAGAATCTTAT
A
TTAGAAAATACACAACTGTTGGAAACCAAAAATGCTTTGAACATAGTGAAGAATGATTTGATAGCAAAA
GTG
GATGAACTGACCTGTGAGAAAGATGTGCTGCAAGGGGAATTGGAGGCTGTGAAGCAAGCCAAACTGA
AA
CTAGAGGAAAAGAACAGAGAATTGGAGGAAGAGCTTAGGAAAGCTCGGGCAGAAGCTGAAGATGCAAG
G
CAAAAAGCAAAAGATGACGATGATAGTGATATTCCCACAGCCCAGAGGAAACGGTTTACTAGAGTAGAA
ATG
GCCCGTGTTCTCATGGAGCGAAACCAGTATAAAGAGAGATTGATGGAGCTTCAGGAAGCTGTTCGAT
GG
ACAGAGATGATTCGGGCATCACGAGAAAATCCAGCCATGCAGGAAAAAAAAAGGTCAAGCATTTGGCA
G
TTTTTCAGCCGACTTTTCAGCTCCTCAAGTAACACGACTAAGAAGCCTGAACCACCTGTTAATCTGAAG
TAC
AATGCACCCACGTCTCATGTTACTCCGTCCGTCAAGAAAAGAAGCAGCACCTTATCTCAGCTCCCTG
GG
GATAAGTCCAAAGCCTTTGATTTCCTTAGTGAAGAAACTGAAGCTAGTTTAGCCTCACGCAGAGAACA
A
AAGAGAGAGCAGTATCGTCAGGTAAAAGCACATGTTCAGAAGGAAGACGGTAGAGTGCAGGCTTTTGGC
TGG
AGTCTGCCTCAGAAGTACAAACAGGTAACCAATGGTCAAGGTGAAAATAAGATGAAAAATTTACCTG
TG
CCTGTCTATCTCAGACCTCTGGATGAAAAAGATACATCAATGAAGCTGTGGTGTGCTGTTGGAGTCAA
T
TTATCTGGTGGGAAGACCAGAGATGGTGGTTCTGTTGTTGGAGCAAGTGTATTTTACAAGGATGTTGCT
GGT
TTGGATACAGAAGGCAGTAAACAGCGAAGTGCCTCTCAGAGTAGTTTAGATAAGTTAGATCAGGAAC
TT
AAGGAACAGCAGAAGGAGTTAAAAAATCAAGAAGAATTATCCAGTCTAGTTTGGATCTGTACCAGCAC
T
CATTCGGCTACAAAAGTTCTTATTATTGATGCTGTTCAACCTGGCAACATCCTAGACAGTTTCACTGTT
TGC
AACTCTCATGTTCTGTGCATTGCAAGTGTGCCAGGTGCACGAGAAACAGACTACCCTGCAGGAGAAG
AT
CTTTCAGAATCTGGTCAGGTAGACAAAGCATCTTTATGTGGAAGTATGACAAGCAACAGCTCAGCAGA
G
ACAGACAGCCTGTTAGGAGGCATCACAGTGGTTGGTTGTTCTGCAGAAGGTGTGACGGGAGCTGCCACT
TCC
CCTAGTACAAATGGTGCTTCTCCAGTGATGGATAAACCACCAGAAATGGAAGCAGAAAATAGTGAGG
TT
GATGAAAATGTTCCAACAGCAGAAGAAGCAACTGAAGCTACAGAAGGGAATGCGGGGTCAGCTGAAGA
C
ACAGTGGACATCTCCCAAACTGGCGTCTACACAGAGCATGTCTTTACAGATCCTTTGGGAGTTCAGATC
CCA
GAAGACCTCTCCCCAGTGTATCAGTCGAGCAATGACTCAGATGCATATAAAGATCAAATATCAGTAC
TG
CCAAATGAACAAGACTTGGTGAGAGAAGAAGCCCAGAAAATGAGTAGTCTTTTACCAACTATGTGGCT
T
GGAGCTCAAAATGGCTGTTTGTATGTCCATTCATCTGTAGCCCAGTGGAGGAAATGTCTCCATTCCATT
AAA
CTTAAAGATTCGATTCTCAGTATTGTACACGTGAAGGGAATCGTGTTAGTAGCCCTGGCTGACGGCA
CC
CTTGCAATCTTTCACAGAGGAGTGGATGGGCAGTGGGATTTGTCAAACTATCACCTCTTAGACCTTGG
A
CGGCCTCATCATTCCATCCGTTGCATGACTGTGGTACATGACAAAGTCTGGTGTGGCTATAGGAACAAA
ATC
TATGTGGTGCAGCCAAAGGCCATGAAAATAGAGAAATCTTTTGATGCACATCCCAGGAAGGAGAGCC
AA
GTGCGACAGCTTGCGTGGGTGGGGGATGGCGTGTGGGTCTCCATTCGCTTGGATTCTACGCTCCGTCT
C
TATCATGCACACACTTATCAACATCTACAGGATGTGGACATTGAGCCTTATGTAAGCAAAATGTTAGGT
ACT
GGAAAACTGGGCTTCTCTTTTGTGAGAATTACAGCTCTTATGGTGTCTTGTAATCGTTTGTGGGTGG
GG
ACAGGAAATGGTGTCATTATCTCCATCCCATTGACAGAAACCGTAATCCTCCACCAGGGACGTTTACT
G
GGGCTGAGGGCAAATAAAACCTCAGGTGTACCAGGAAATCGTCCTGGAAGTGTAATCCGTGTATATGGT
GAT
GAAAACAGTGATAAAGTGACTCCAGGGACATTTATACCCTATTGTTCAATGGCACATGCACAGCTTT
GC
TTCCATGGGCACCGGGATGCTGTGAAATTCTTTGTGGCAGTCCCAGGTCAAGTCATCAGCCCACAAAG
T
AGCAGTAGTGGCACGGATCTGACGGGTGACAAAGCAGGGCCATCTGCACAGGAGCCTGGTAGTCAGACG
CCC
TTGAAGTCTATGCTTGTCATCAGTGGAGGAGAGGGCTACATCGACTTCCGAATGGGTGATGAAGGTG
GA
GAATCAGAACTTCTTGGAGAGGATCTTCCACTTGAACCTTCTGTCACCAAAGCAGAAAGGAGTCACTT
G
ATAGTGTGGCAAGTGATGTATGGCAATGAGTGA


Translation (1177 aa):
MSPGCMLLFVFGFVGGAVVINSAILVSLSVLLLVHFSISTGVPALTQNLPRILRKERPISLGIFPLPAGD
G
LLTPDAQKGGETPGSEQWKFQELSQPRSHTSLK
DELSDVSQGGSKATTPASTANSDVATIPTDTPLKEE
N
EGFVKVTDAPNKSEISKHIEVQVAQETRNVST
GSAENEEKSEVQAIIESTPELDMDKDLSGYKGSSTPT
K
GIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLL
GMGREVENLILENTQLLETKNALNIVKNDLIAK
V
DELTCEKDVLQGELEAVKQAKLKLEEKNRELEEELR
KARAEAEDARQKAKDDDDSDIPTAQRKRFTRVE
M
ARVLMERNQYKERLMELQEAVRWTEMI
RASRENPAMQEKKRSSIWQFFSRLFSSSSNTTKKPEPPVNLK
Y
NAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSE
ETEASLASRREQKREQYRQVKAHVQKEDGRVQAFG
W
SLPQKYKQ
VTNGQGENKMKNLPVPVYLRPLDEKDTSMKLWCAVGVNLSGGKTRDGGSVVGASVFYKDVA
G
LDTEGSKQRSASQSSLDKLDQELK
EQQKELKNQEELSSLVWICTSTHSATKVLIIDAVQPGNILDSFTV
C
NSHVLCIASVP
GARETDYPAGEDLSESGQVDKASLCGSMTSNSSAETDSLLGGITVVGCSAEGVTGAAT
S
PSTNGASPVMDKPP
EMEAENSEVDENVPTAEEATEATEGNAGSAEDTVDISQTGVYTEHVFTDPLGVQI
P
EDLSPVYQS
SNDSDAYKDQISVLPNEQDLVREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSI
K
LKDSILSI
VHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRCMTVVHDKVWCGYRNK
I
YVVQPKAMKIE
KSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTLRLYHAHTYQHLQDVDIEPYVSKMLG
T
GKLGFSFVRITALMVSCNRLWVGTGNGVIISIPLTE
TVILHQGRLLGLRANKTSGVPGNRPGSVIRVYG
D
ENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAVP
GQVISPQSSSSGTDLTGDKAGPSAQEPGSQT
P
LKSMLVISGGEGYIDFRM
GDEGGESELLGEDLPLEPSVTKAERSHLIVWQVMYGNE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser