NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS58352.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58352.1 Public Homo sapiens 15 SLC12A6 22 109 92 CCDS HistoryNCBI Gene:9990Re-query CCDS DB by CCDS ID:58352.1Re-query CCDS DB by GeneID:9990See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58352.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000354181.7 ENSP00000346112.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000354181.7Link to Ensembl Protein Viewer:ENSP00000346112.3Re-query CCDS DB by Nucleotide ID:ENST00000354181Re-query CCDS DB by Protein ID:ENSP00000346112
Original member Current member EBI ENST00000558667.5 ENSP00000453473.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000558667.5Link to Ensembl Protein Viewer:ENSP00000453473.1Re-query CCDS DB by Nucleotide ID:ENST00000558667Re-query CCDS DB by Protein ID:ENSP00000453473
Original member Current member EBI ENST00000560611.5 ENSP00000454168.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000560611.5Link to Ensembl Protein Viewer:ENSP00000454168.1Re-query CCDS DB by Nucleotide ID:ENST00000560611Re-query CCDS DB by Protein ID:ENSP00000454168
Original member NCBI NM_133647.1 NP_598408.1 Updated not alive Link to Nucleotide Sequence:NM_133647.1Link to Protein Sequence:NP_598408.1Re-query CCDS DB by Nucleotide ID:NM_133647Re-query CCDS DB by Protein ID:NP_598408
Current member NCBI NM_133647.2 NP_598408.1 Accepted alive Link to Nucleotide Sequence:NM_133647.2Link to Protein Sequence:NP_598408.1Re-query CCDS DB by Nucleotide ID:NM_133647Re-query CCDS DB by Protein ID:NP_598408Link to BLAST:NP_598408.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598408.1 1150 Q9UHW9-1 1150 100% 0 0

Chromosomal Locations for CCDS 58352.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 15 (NC_000015.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 34233881 34233972 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34235181 34235314 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34236015 34236199 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34236708 34236815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34237419 34237550 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34238232 34238401 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34238965 34239160 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34240661 34240829 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34241233 34241337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34242102 34242221 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34243974 34244072 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34245285 34245403 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34245693 34245867 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34250298 34250355 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34250631 34250729 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34250899 34251057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34252170 34252384 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34254348 34254589 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34255262 34255392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34256229 34256283 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34257642 34257788 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34258813 34258944 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34260926 34261020 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34275345 34275389 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15
15 34336410 34336680 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3453 nt):
ATGCATCCTCCAGAAACCACCACCAAGATGGCTTCAGTTCGGTTCATGGTGACACCGACAAAGATCGATG
AC
ATTCCAGGTTTGTCAGACACCAGTCCGGACCTCAGCTCTCGATCTAGTTCCCGAGTAAGATTTAGCTC
C
CGGGAAAGCGTGCCTGAAACAAGCCGGAGTGAGCCTATGAGTGAGATGTCTGGGGCCACCACTTCGCTG
GCA
ACTGTTGCACTGGATCCACCCAGTGACCGGACTTCTCACCCCCAGGATGTCATCGAGGACCTGAGTC
AG
AACTCCATCACAGGGGAACACAGCCAACTGTTAGACGACGGACATAAGAAAGCTCGAAATGCTTATCT
C
AATAATTCCAATTATGAAGAAGGAGATGAATATTTTGATAAAAATTTGGCACTCTTTGAGGAAGAAATG
GAC
ACCAGACCGAAGGTGTCTTCCCTCCTCAACCGCATGGCCAATTACACTAATCTGACTCAAGGAGCAA
AG
GAACATGAAGAGGCAGAAAACATCACTGAAGGGAAAAAGAAGCCCACCAAGACCCCCCAAATGGGTAC
C
TTCATGGGTGTCTACCTCCCATGTCTACAAAATATTTTTGGAGTGATCCTTTTTTTACGCCTTACATGG
GTG
GTGGGCACAGCTGGAGTTCTTCAGGCTTTTGCAATTGTCCTTATCTGCTGCTGCTGTACAATGTTGA
CT
GCTATCTCCATGAGTGCCATTGCCACTAATGGAGTGGTGCCAGCTGGGGGCTCATACTTTATGATTTC
C
CGGGCACTGGGCCCAGAGTTTGGTGGGGCTGTTGGCCTCTGCTTTTATCTTGGTACCACATTTGCAGCA
GCC
ATGTACATCCTTGGTGCCATTGAAATCTTTCTGGTCTATATCGTCCCCCGAGCTGCCATCTTTCACA
GT
GATGACGCACTCAAGGAATCAGCAGCCATGCTAAATAACATGCGTGTCTACGGCACAGCTTTCTTGGT
C
CTTATGGTATTAGTGGTATTTATCGGCGTACGCTATGTGAACAAGTTTGCCTCACTTTTCCTGGCCTGT
GTC
ATTGTGTCCATCTTGGCCATCTATGCTGGAGCCATCAAGTCTTCTTTTGCTCCTCCACACTTCCCGG
TC
TGCATGCTGGGTAACCGCACCCTTTCATCAAGACACATTGACGTTTGCTCTAAGACCAAGGAAATTAA
C
AACATGACAGTCCCATCAAAGTTATGGGGATTCTTCTGTAACTCGAGTCAATTTTTCAATGCCACCTGT
GAT
GAATACTTTGTTCACAATAACGTCACTTCAATCCAGGGCATTCCTGGATTGGCTAGTGGTATAATTA
CA
GAGAATCTTTGGAGTAATTACCTACCCAAGGGAGAGATCATCGAAAAGCCTTCAGCCAAATCTTCTGA
T
GTCTTAGGCAGCTTAAACCATGAATATGTTCTTGTTGACATCACCACCTCCTTCACGCTTCTGGTGGGA
ATC
TTCTTTCCCTCTGTTACAGGTATCATGGCTGGATCAAACAGATCTGGAGATCTGAAAGATGCTCAGA
AG
TCTATTCCGATTGGTACTATCCTTGCCATCCTGACCACCTCCTTTGTTTATTTAAGCAATGTTGTCCT
T
TTTGGTGCATGTATTGAAGGGGTTGTTCTCAGAGACAAGTTCGGTGATGCTGTGAAAGGTAATTTGGTG
GTA
GGCACCTTATCTTGGCCATCCCCATGGGTGATTGTTATTGGCTCCTTCTTTTCAACATGTGGGGCTG
GA
CTTCAGAGCCTCACAGGTGCACCGAGGCTGCTACAAGCTATTGCCAAGGATAACATCATACCGTTTCT
G
AGGGTTTTTGGCCACAGCAAAGCCAATGGGGAACCTACCTGGGCTTTACTTCTAACTGCTGCCATTGCA
GAG
CTTGGAATACTCATTGCCTCCCTGGATCTTGTGGCCCCAATTCTTTCCATGTTTTTTCTCATGTGTT
AC
CTCTTTGTAAACTTGGCATGTGCCTTGCAAACATTACTTCGAACACCCAACTGGAGACCCCGATTCCG
C
TACTACCATTGGGCCCTTTCTTTCATGGGAATGAGTATCTGTCTGGCTCTGATGTTCATTTCTTCCTGG
TAT
TATGCCATTGTAGCCATGGTAATAGCTGGTATGATCTACAAGTACATTGAATACCAAGGAGCTGAGA
AA
GAATGGGGTGATGGTATCCGTGGGCTGTCCCTCAGTGCAGCCCGGTTTGCTTTGCTTCGATTGGAGGA
A
GGACCTCCACACACTAAAAACTGGAGGCCTCAGTTGCTTGTATTACTGAAACTAGATGAAGACTTACAT
GTC
AAGCATCCTCGCCTCCTCACCTTTGCCTCACAGCTCAAAGCAGGAAAAGGTCTCACTATTGTGGGCT
CT
GTCATCGTGGGGAACTTCCTAGAGAACTACGGTGAAGCTTTAGCTGCTGAGCAGACCATAAAGCACCT
A
ATGGAGGCAGAGAAGGTAAAAGGATTCTGCCAGCTGGTGGTGGCCGCCAAGCTGAGAGAGGGCATTTCC
CAC
CTCATCCAGTCATGTGGCCTTGGGGGCATGAAGCACAACACGGTGGTGATGGGCTGGCCTAATGGCT
GG
CGTCAAAGCGAAGATGCCCGCGCTTGGAAGACTTTTATTGGCACAGTTCGAGTGACAACTGCTGCCCA
T
CTTGCACTGCTGGTGGCTAAAAACATCTCCTTCTTTCCCAGCAATGTGGAGCAATTTTCTGAGGGCAAC
ATT
GATGTGTGGTGGATTGTGCATGATGGGGGGATGCTTATGCTACTACCATTCCTACTGAAACAGCACA
AG
GTGTGGCGAAAGTGCAGCATACGGATCTTCACAGTAGCCCAATTAGAAGACAACAGTATCCAAATGAA
G
AAGGACCTAGCCACCTTCCTATATCACTTACGCATTGAGGCGGAGGTAGAAGTGGTGGAGATGCATGAC
AGT
GATATATCAGCATATACTTACGAGCGCACTTTGATGATGGAACAAAGGTCCCAGATGCTCCGGCACA
TG
CGGCTATCCAAAACAGAGCGAGACAGAGAGGCACAATTGGTGAAAGACCGAAACTCAATGCTACGATT
G
ACCAGCATTGGCTCTGATGAGGACGAAGAGACAGAAACCTATCAGGAGAAGGTGCACATGACTTGGACA
AAA
GACAAGTACATGGCATCCCGGGGACAAAAAGCGAAGTCAATGGAAGGATTCCAGGACCTGCTTAACA
TG
CGTCCGGACCAGTCCAATGTGAGGCGGATGCATACAGCAGTGAAACTCAACGAGGTTATAGTTAACAA
G
TCCCATGAAGCAAAGCTGGTTTTATTGAATATGCCAGGGCCACCCCGAAACCCTGAGGGTGATGAAAAC
T
AC
ATGGAGTTCCTAGAGGTGCTTACCGAGGGACTAGAGCGAGTCCTACTTGTCCGGGGTGGTGGCAGTG
AA
GTGATCACCATTTATTCATAA


Translation (1150 aa):
MHPPETTTKMASVRFMVTPTKIDDIPGLSDTSPDLSSRSSSRVRFSSRESVPETSRSEPMSEMSGATTSL
A
TVALDPPSDRTSHPQDVIE
DLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEM
D
TRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTK
TPQMGTFMGVYLPCLQNIFGVILFLRLTW
V
VGTAGVLQAFAIVLICCCC
TMLTAISMSAIATNGVVPAGGSYFMISRALGPEFGGAVGLCFYLGTTFAA
A
MYILGAIEIFL
VYIVPRAAIFHSDDALKESAAMLNNMRVYGTAFLVLMVLVVFIGVRYVNKFASLFLAC
V
IVSILAIYAGAIKSSFAPPHF
PVCMLGNRTLSSRHIDVCSKTKEINNMTVPSKLWGFFCNSSQFFNATC
D
EYFVHNNVTSIQGIPGLASGIIT
ENLWSNYLPKGEIIEKPSAKSSDVLGSLNHEYVLVDITTSFTLLVG
I
FFPSVT
GIMAGSNRSGDLKDAQKSIPIGTILAILTTSFVYLSNVVLFGACIEGVVLRDKFGDAVKGNLV
V
GTLSWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIAKDNIIPFLR
VFGHSKANGEPTWALLLTAAIA
E
LGILIASLDLVAPILS
MFFLMCYLFVNLACALQTLLRTPNWRPRFRYYHWALSFMGMSICLALMFISSW
Y
YAIVAMVIAGMIYKYIEYQ
GAEKEWGDGIRGLSLSAARFALLRLEEGPPHTKNWRPQLLVLLKLDEDLH
V
KHPRLLTFASQLKAGKGLTIVGSVIVGNFLENYGEALAAEQ
TIKHLMEAEKVKGFCQLVVAAKLREGIS
H
LIQSCGLGGMKHNTVVMGWPNGWRQSEDARAWKTFI
GTVRVTTAAHLALLVAKNISFFPSNVEQFSEGN
I
DVWWIVHDGGMLMLLPFLLKQHK
VWRKCSIRIFTVAQLEDNSIQMKKDLATFLYHLRIEAEVEVVEMHD
S
DISAYTYERTLMMEQRSQMLRHMRLSKTERDRE
AQLVKDRNSMLRLTSIGSDEDEETETYQEKVHMTWT
K
DKYMASRGQKAKSMEGFQDLLNMR
PDQSNVRRMHTAVKLNEVIVNKSHEAKLVLLNMPGPPRNPEGDEN
Y
MEFLEVLTEGLERVLLVRGGGSEVITIYS



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser