NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq


Report for CCDS58266.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
58266.1 Public Homo sapiens 12 LTA4H 22 109 92 CCDS HistoryNCBI Gene:4048Re-query CCDS DB by CCDS ID:58266.1Re-query CCDS DB by GeneID:4048See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 11, NCBI annotation release 103, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 58266.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000413268.6 ENSP00000395051.2 Accepted alive Link to Ensembl Transcript Viewer:ENST00000413268.6Link to Ensembl Protein Viewer:ENSP00000395051.2Re-query CCDS DB by Nucleotide ID:ENST00000413268Re-query CCDS DB by Protein ID:ENSP00000395051
Original member Current member NCBI NM_001256644.1 NP_001243573.1 Accepted alive Link to Nucleotide Sequence:NM_001256644.1Link to Protein Sequence:NP_001243573.1Re-query CCDS DB by Nucleotide ID:NM_001256644Re-query CCDS DB by Protein ID:NP_001243573Link to BLAST:NP_001243573.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001243573.1 508 P09960-3 508 100% 0 0

Chromosomal Locations for CCDS 58266.1

Assembly GRCh38.p12 (GCF_000001405.38)

On '-' strand of Chromosome 12 (NC_000012.12)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 96002996 96003064 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96006314 96006409 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96009094 96009148 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96013188 96013258 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96013750 96013853 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96014855 96014999 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96015583 96015694 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96017044 96017114 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96017557 96017580 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96018763 96018903 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96019168 96019240 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96021085 96021137 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96022147 96022251 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96024479 96024547 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96027444 96027564 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96029055 96029185 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12
12 96043289 96043375 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1527 nt):
ATGCTGCCACAGAGAAATCTTTCTAAAAGACAAGTACCGACCATGCATATCCCAGTTAAGACTCGTCGAC
TT
CTTGCAGCCTTAAAGGTTTTGGATACAAAGGACCTTACAATAGAAAAAGTAGTGATCAATGGACAAGA
A
GTCAAATATGCTCTTGGAGAAAGACAAAGTTACAAGGGATCGCCAATGGAAATCTCTCTTCCTATCGCT
TTG
AGCAAAAATCAAGAAATTGTTATAGAAATTTCTTTTGAGACCTCTCCAAAATCTTCTGCTCTCCAGT
GG
CTCACTCCTGAACAGACTTCTGGGAAGGAACACCCATATCTCTTTAGTCAGTGCCAGGCCATCCACTG
C
AGAGCAATCCTTCCTTGTCAGGACACTCCTTCTGTGAAATTAACCTATACTGCAGAGGTGTCTGTCCCT
AAA
GAACTGGTGGCACTTATGAGTGCTATTCGTGATGGAGAAACACCTGACCCAGAAGACCCAAGCAGGA
AA
ATATACAAATTCATCCAAAAAGTTCCAATACCCTGCTACCTGATTGCTTTAGTTGTTGGAGCTTTAGA
A
AGCAGGCAAATTGGCCCAAGAACTTTGGTGTGGTCTGAGAAAGAGCAGGTGGAAAAGTCTGCTTATGAG
TTT
TCTGAGACTGAATCTATGCTTAAAATAGCAGAAGATCTGGGAGGACCGTATGTATGGGGACAGTATG
AC
CTATTGGTCCTGCCACCATCCTTCCCTTATGGTGGCATGGAGAATCCTTGCCTTACTTTTGTAACTCC
T
ACTCTACTGGCAGGCGACAAGTCACTCTCCAATGTCATTGCACATGAAATATCTCATAGCTGGACAGGG
AAT
CTAGTGACCAACAAAACTTGGGATCACTTTTGGTTAAATGAGGGACATACTGTGTACTTGGAACGCC
AC
ATTTGCGGACGATTGTTTGGTGAAAAGTTCAGACATTTTAATGCTCTGGGAGGATGGGGAGAACTACA
G
AATTCGGTAAAGACATTTGGGGAGACACATCCTTTCACCAAACTTGTGGTTGATCTGACAGATATAGAC
CCT
GATGTAGCTTATTCTTCAGTTCCCTATGAGAAGGGCTTTGCTTTACTTTTTTACCTTGAACAACTGC
TT
GGAGGACCAGAGATTTTCCTAGGATTCTTAAAAGCTTATGTTGAGAAGTTTTCCTATAAGAGCATAAC
T
ACTGATGACTGGAAGGATTTCCTGTATTCCTATTTTAAAGATAAGGTTGATGTTCTCAATCAAGTTGAT
TGG
AATGCCTGGCTCTACTCTCCTGGACTGCCTCCCATAAAGCCCAATTATGATATGACTCTGACAAATG
CT
TGTATTGCCTTAAGTCAAAGATGGATTACTGCCAAAGAAGATGATTTAAATTCATTCAATGCCACAGA
C
CTGAAGGATCTCTCTTCTCATCAATTGAATGAGTTTTTAGCACAGACGCTCCAGAGGATGGCTGCGGCT
CTG
CATTCAATCCAAGTGGGAGGACGCAATTCCTTTGGCGCTAAAGATGGCAACTGA


Translation (508 aa):
MLPQRNLSKRQVPTMHIPVKTRRLLAALKVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIA
L
S
KNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVP
K
ELVALMSAIRDGETPDPEDPSRKIYKFIQK
VPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYE
F
SE
TESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTG
N
LVTNKTWDHF
WLNEGHTVYLERHICGRLFGEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDID
P
DVAYSSVPYEKGFALLFYLEQLLGGP
EIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDVLNQVD
W
NAWLYSPGLPPIKP
NYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDLSSHQLNEFLAQTLQRMAAA
L
HSIQVGGRNSFGAKDGN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser